F243731

General Info

Members Datasets Scaffolds Average Seq Length
164 131 328 311

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10118797|Ga0099794_101187972
Length 342
Sequence MVGVLETSNRSKGAGQLMIAIVPIAMAAGCASALMFVSIVSGAPISLLLLYFAPLPLMVAALGWGPLAATVGGIMAATTIGAIFGFPLCIAFVITIALPAWWLGHLALLGRPVTNVVSSGNGASPVAPTLEWYPIGRILLWISGFAVLTTLAALLTLGSDVAVITETLRRGLLRFVGPRDAASAGEIEQQIDALVAIGPALAANVAMLRLTLNLWLATKIAATSGRLHRPKPDLKSVALPPMTLVVLTVAVALCFVGGLLAMVAQIVAAALMMAYALTGFAVLHTLTLGSKNRGLWLSCTYAILVLSGGWLIVVMLALGLADAIFGFRQRYLQRRPPPIPAS

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
21 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
22 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
23 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
46 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
47 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
48 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
50 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
51 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
55 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
67 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
68 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
69 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
70 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
71 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
76 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
77 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
78 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
79 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
80 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
81 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
94 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
100 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
101 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
102 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
109 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
110 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
111 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
112 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
113 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
114 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
115 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
116 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
119 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
120 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
121 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
122 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
123 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
126 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
127 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
128 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
129 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
130 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
131 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.73
Metatranscriptomes 0
Isolates 4.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.63
Nodule 6.1
Rhizoplane 5.49
Rhizosphere 62.8
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10118797 3300007265 Bacteria 1329
2 JGI25406J46586_10000078 3300003203 Bacteria 44054
3 JGI25404J52841_10034277 3300003659 Bacteria 1081
4 Ga0070674_100110389 3300005356 Bacteria 2018
5 Ga0070714_100013429 3300005435 Bacteria 6563
6 Ga0070714_100189027 3300005435 Bacteria 1878
7 Ga0070713_100041858 3300005436 Bacteria 3735
8 Ga0070713_100200618 3300005436 Bacteria 1801
9 Ga0070710_10002082 3300005437 Bacteria 9481
10 Ga0070663_100245000 3300005455 Bacteria 1416
11 Ga0070678_100058880 3300005456 Bacteria 2821
12 Ga0070707_100263407 3300005468 Bacteria 1677
13 Ga0070698_100038779 3300005471 Bacteria 4909
14 Ga0068856_100000205 3300005614 Bacteria 63226
15 Ga0081455_10008547 3300005937 Bacteria 10625
16 Ga0081455_10144726 3300005937 Bacteria 1841
17 Ga0081538_10042736 3300005981 Bacteria 2855
18 Ga0081540_1002794 3300005983 Bacteria 14150
19 Ga0081540_1043935 3300005983 Bacteria 2286
20 Ga0081539_10000273 3300005985 Bacteria 117936
21 Ga0070717_10117831 3300006028 Bacteria 2271
22 Ga0070717_10189588 3300006028 Bacteria 1796
23 Ga0075365_10001079 3300006038 Bacteria 11831
24 Ga0075365_10028819 3300006038 Bacteria 3543
25 Ga0070715_10001114 3300006163 Bacteria 7641
26 Ga0099825_1035517 3300006941 Bacteria 1777
27 Ga0099824_1004347 3300006942 Bacteria 20415
28 Ga0099822_1002380 3300006943 Bacteria 23355
29 Ga0099794_10066468 3300007265 Bacteria 1760
30 Ga0099794_10095293 3300007265 Bacteria 1481
31 Ga0099795_10056999 3300007788 Bacteria 1439
32 Ga0105248_10257129 3300009177 Bacteria 1966
33 Ga0105248_10738782 3300009177 Bacteria 1110
34 Ga0105238_10029387 3300009551 Bacteria 5600
35 Ga0099796_10010869 3300010159 Bacteria 2519
36 Ga0209758_1006712 3300025297 Bacteria 8112
37 Ga0207692_10004604 3300025898 Bacteria 5469
38 Ga0207685_10016873 3300025905 Bacteria 2347
39 Ga0207699_10010865 3300025906 Bacteria 4584
40 Ga0207684_10339437 3300025910 Bacteria 1294
41 Ga0207693_10003087 3300025915 Bacteria 14354
42 Ga0207663_10014724 3300025916 Bacteria 4293
43 Ga0207663_10275180 3300025916 Bacteria 1249
44 Ga0207646_10099879 3300025922 Bacteria 2601
45 Ga0207694_10088220 3300025924 Bacteria 2445
46 Ga0207687_10130413 3300025927 Bacteria 1894
47 Ga0207687_10331913 3300025927 Bacteria 1234
48 Ga0207700_10049755 3300025928 Bacteria 3119
49 Ga0207664_10171443 3300025929 Bacteria 1857
50 Ga0207669_10051510 3300025937 Bacteria 2467
51 Ga0207665_10005701 3300025939 Bacteria 8296
52 Ga0207665_10073837 3300025939 Bacteria 2333
53 Ga0207640_10037668 3300025981 Bacteria 3045
54 Ga0207678_10294173 3300026067 Bacteria 1395
55 Ga0207702_10000048 3300026078 Bacteria 143125
56 Ga0207683_10263045 3300026121 Bacteria 1575
57 Ga0209589_1000001 3300027357 Bacteria 794224
58 Ga0209489_100001 3300027361 Bacteria 794224
59 Ga0209700_100001 3300027363 Bacteria 794224
60 Ga0209179_1010567 3300027512 Bacteria 1613
61 Ga0209179_1015620 3300027512 Bacteria 1413
62 Ga0307508_10059145 3300031616 Bacteria 3390
63 Ga0307516_10062663 3300031730 Bacteria 3603
64 Ga0373923_0044684 3300035111 Bacteria 1837
65 Ga0373935_0502244 3300035692 Bacteria 880
66 Ga0373927_0024864 3300035695 Bacteria 3914
67 Ga0373933_0000235 3300035724 Bacteria 36446
68 Ga0373925_0056319 3300037068 Bacteria 2945
69 Ga0436365_0220466 3300039437 Bacteria 2065
70 Ga0436363_1609785 3300039450 Bacteria 1232
71 Ga0466967_0075339 3300045976 Bacteria 3033
72 Ga0495651_0058996 3300046462 Bacteria 2944
73 Ga0495651_0093330 3300046462 Bacteria 2253
74 Ga0495606_0009461 3300046507 Bacteria 8243
75 Ga0495628_0386747 3300046516 Bacteria 1024
76 Ga0495652_0166592 3300046529 Bacteria 1705
77 Ga0495668_0158494 3300046616 Bacteria 1240
78 Ga0495659_0047899 3300046664 Bacteria 1547
79 Ga0495658_0361890 3300046683 Bacteria 922
80 Ga0495670_0121341 3300046691 Bacteria 1358
81 Ga0495600_0029006 3300046809 Bacteria 3582
82 Ga0495600_0075688 3300046809 Bacteria 2198
83 Ga0495686_0164743 3300047472 Bacteria 1293
84 Ga0496101_0261491 3300048904 Bacteria 1350
85 Ga0496104_0283353 3300048907 Bacteria 1570
86 Ga0496108_0612348 3300048911 Bacteria 948
87 Ga0496110_0160914 3300048913 Bacteria 2035
88 Ga0496112_0000021 3300048915 Bacteria 156561
89 Ga0496112_0004119 3300048915 Bacteria 12227
90 Ga0496113_0139055 3300048916 Bacteria 1910
91 Ga0496115_0132430 3300048918 Bacteria 2055
92 Ga0496115_0183255 3300048918 Bacteria 1731
93 Ga0496118_0068971 3300048921 Bacteria 2564
94 Ga0496119_0050391 3300048922 Bacteria 2567
95 Ga0496119_0190371 3300048922 Bacteria 1069
96 Ga0496121_0000937 3300048924 Bacteria 52775
97 Ga0496121_0091603 3300048924 Bacteria 2373
98 Ga0496125_0000272 3300048928 Bacteria 105490
99 Ga0496125_0004388 3300048928 Bacteria 16331
100 Ga0496126_0009083 3300048929 Bacteria 10624
101 Ga0496126_0012554 3300048929 Bacteria 8671
102 Ga0496126_0044865 3300048929 Bacteria 4068
103 Ga0496126_0197687 3300048929 Bacteria 1699
104 Ga0501033_0005237 3300049570 Bacteria 10295
105 Ga0501034_0125195 3300049571 Bacteria 2555
106 Ga0501034_0237748 3300049571 Bacteria 1768
107 Ga0501036_0139921 3300049572 Bacteria 2042
108 Ga0501037_0014018 3300049573 Bacteria 5905
109 Ga0501038_0009854 3300049574 Bacteria 8744
110 Ga0501038_0012791 3300049574 Bacteria 7663
111 Ga0501039_0037824 3300049575 Bacteria 3726
112 Ga0501040_0004593 3300049576 Bacteria 8960
113 Ga0501042_0070866 3300049578 Bacteria 2493
114 Ga0501043_0054313 3300049579 Bacteria 3145
115 Ga0501046_0130504 3300049580 Bacteria 1906
116 Ga0501047_0006124 3300049581 Bacteria 11304
117 Ga0501047_0020190 3300049581 Bacteria 6397
118 Ga0501048_0006405 3300049582 Bacteria 8948
119 Ga0501067_0047540 3300049583 Bacteria 2379
120 Ga0501068_0004997 3300049584 Bacteria 7221
121 Ga0501069_0052393 3300049585 Bacteria 2272
122 Ga0501070_0040250 3300049586 Bacteria 3897
123 Ga0501071_0188741 3300049587 Bacteria 1545
124 Ga0501072_0080720 3300049588 Bacteria 2577
125 Ga0501073_0043929 3300049589 Bacteria 3150
126 Ga0501074_0015059 3300049590 Bacteria 5626
127 Ga0501075_0031290 3300049591 Bacteria 3949
128 Ga0501079_0043909 3300049741 Bacteria 3450
129 Ga0501080_0019601 3300049742 Bacteria 6266
130 Ga0501035_0028562 3300049822 Bacteria 5091
131 Ga0501035_0267604 3300049822 Bacteria 1447
132 Ga0501044_0031528 3300049823 Bacteria 5578
133 Ga0501044_0047774 3300049823 Bacteria 4425
134 Ga0501044_0069730 3300049823 Bacteria 3578
135 nmdc:mga00v17_6555_c1 3300050491 Bacteria 5696
136 Ga0495601_0294280 3300053077 Bacteria 1058
137 Ga0500635_0007262 3300053080 Bacteria 3000
138 Ga0500647_0024728 3300053091 Bacteria 2826
139 Ga0500566_0000026 3300053094 Bacteria 77138
140 Ga0500650_0044180 3300053098 Bacteria 2062
141 Ga0500572_001027 3300053111 Bacteria 8393
142 Ga0500594_0001859 3300053118 Bacteria 4573
143 Ga0500594_0033517 3300053118 Bacteria 1366
144 Ga0500595_008233 3300053119 Bacteria 4272
145 Ga0500595_033473 3300053119 Bacteria 1705
146 Ga0500608_003190 3300053122 Bacteria 6097
147 Ga0500614_000981 3300053123 Bacteria 7102
148 Ga0500559_0027025 3300053136 Bacteria 2448
149 Ga0500603_000452 3300053150 Bacteria 10611
150 Ga0500603_000591 3300053150 Bacteria 9040
151 Ga0500630_000362 3300053159 Bacteria 19136
152 Ga0500638_013991 3300053162 Bacteria 3648
153 Ga0500639_000939 3300053163 Bacteria 14837
154 Ga0500637_0000450 3300053178 Bacteria 15794
155 Ga0500637_0052312 3300053178 Bacteria 2329
156 Ga0500570_029019 3300053724 Bacteria 3008
157 Ga0501084_0122896 3300054114 Bacteria 2183
158 2513674910 2513237098 Bacteria 9902361
159 2524470610 2524023210 Bacteria 9029266
160 2643756647 2643221547 Bacteria 4740017
161 2885391852 2885383462 Bacteria 9473874
162 2903776884 2903768456 Bacteria 9749579
163 8006967176 8006964411 Bacteria 8966052
164 8056686758 8056681323 Bacteria 8472857
165 Ga0099794_10118797
166 JGI25406J46586_10000078
167 JGI25404J52841_10034277
168 Ga0070674_100110389
169 Ga0070714_100013429
170 Ga0070714_100189027
171 Ga0070713_100041858
172 Ga0070713_100200618
173 Ga0070710_10002082
174 Ga0070663_100245000
175 Ga0070678_100058880
176 Ga0070707_100263407
177 Ga0070698_100038779
178 Ga0068856_100000205
179 Ga0081455_10008547
180 Ga0081455_10144726
181 Ga0081538_10042736
182 Ga0081540_1002794
183 Ga0081540_1043935
184 Ga0081539_10000273
185 Ga0070717_10117831
186 Ga0070717_10189588
187 Ga0075365_10001079
188 Ga0075365_10028819
189 Ga0070715_10001114
190 Ga0099825_1035517
191 Ga0099824_1004347
192 Ga0099822_1002380
193 Ga0099794_10066468
194 Ga0099794_10095293
195 Ga0099795_10056999
196 Ga0105248_10257129
197 Ga0105248_10738782
198 Ga0105238_10029387
199 Ga0099796_10010869
200 Ga0209758_1006712
201 Ga0207692_10004604
202 Ga0207685_10016873
203 Ga0207699_10010865
204 Ga0207684_10339437
205 Ga0207693_10003087
206 Ga0207663_10014724
207 Ga0207663_10275180
208 Ga0207646_10099879
209 Ga0207694_10088220
210 Ga0207687_10130413
211 Ga0207687_10331913
212 Ga0207700_10049755
213 Ga0207664_10171443
214 Ga0207669_10051510
215 Ga0207665_10005701
216 Ga0207665_10073837
217 Ga0207640_10037668
218 Ga0207678_10294173
219 Ga0207702_10000048
220 Ga0207683_10263045
221 Ga0209589_1000001
222 Ga0209489_100001
223 Ga0209700_100001
224 Ga0209179_1010567
225 Ga0209179_1015620
226 Ga0307508_10059145
227 Ga0307516_10062663
228 Ga0373923_0044684
229 Ga0373935_0502244
230 Ga0373927_0024864
231 Ga0373933_0000235
232 Ga0373925_0056319
233 Ga0436365_0220466
234 Ga0436363_1609785
235 Ga0466967_0075339
236 Ga0495651_0058996
237 Ga0495651_0093330
238 Ga0495606_0009461
239 Ga0495628_0386747
240 Ga0495652_0166592
241 Ga0495668_0158494
242 Ga0495659_0047899
243 Ga0495658_0361890
244 Ga0495670_0121341
245 Ga0495600_0029006
246 Ga0495600_0075688
247 Ga0495686_0164743
248 Ga0496101_0261491
249 Ga0496104_0283353
250 Ga0496108_0612348
251 Ga0496110_0160914
252 Ga0496112_0000021
253 Ga0496112_0004119
254 Ga0496113_0139055
255 Ga0496115_0132430
256 Ga0496115_0183255
257 Ga0496118_0068971
258 Ga0496119_0050391
259 Ga0496119_0190371
260 Ga0496121_0000937
261 Ga0496121_0091603
262 Ga0496125_0000272
263 Ga0496125_0004388
264 Ga0496126_0009083
265 Ga0496126_0012554
266 Ga0496126_0044865
267 Ga0496126_0197687
268 Ga0501033_0005237
269 Ga0501034_0125195
270 Ga0501034_0237748
271 Ga0501036_0139921
272 Ga0501037_0014018
273 Ga0501038_0009854
274 Ga0501038_0012791
275 Ga0501039_0037824
276 Ga0501040_0004593
277 Ga0501042_0070866
278 Ga0501043_0054313
279 Ga0501046_0130504
280 Ga0501047_0006124
281 Ga0501047_0020190
282 Ga0501048_0006405
283 Ga0501067_0047540
284 Ga0501068_0004997
285 Ga0501069_0052393
286 Ga0501070_0040250
287 Ga0501071_0188741
288 Ga0501072_0080720
289 Ga0501073_0043929
290 Ga0501074_0015059
291 Ga0501075_0031290
292 Ga0501079_0043909
293 Ga0501080_0019601
294 Ga0501035_0028562
295 Ga0501035_0267604
296 Ga0501044_0031528
297 Ga0501044_0047774
298 Ga0501044_0069730
299 nmdc:mga00v17_6555_c1
300 Ga0495601_0294280
301 Ga0500635_0007262
302 Ga0500647_0024728
303 Ga0500566_0000026
304 Ga0500650_0044180
305 Ga0500572_001027
306 Ga0500594_0001859
307 Ga0500594_0033517
308 Ga0500595_008233
309 Ga0500595_033473
310 Ga0500608_003190
311 Ga0500614_000981
312 Ga0500559_0027025
313 Ga0500603_000452
314 Ga0500603_000591
315 Ga0500630_000362
316 Ga0500638_013991
317 Ga0500639_000939
318 Ga0500637_0000450
319 Ga0500637_0052312
320 Ga0500570_029019
321 Ga0501084_0122896
322 2513674910
323 2524470610
324 2643756647
325 2885391852
326 2903776884
327 8006967176
328 8056686758

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.599 31 212
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.4948 31 212
4mhw-assembly1.cif.gz_A crystal structure of thit with small molecule bat-25 0.4196 34 198
4tkr-assembly1.cif.gz_A native-sad phasing for thit from listeria monocytogenes serovar. 0.3853 5 209
4tkr-assembly1.cif.gz_A native-sad phasing for thit from listeria monocytogenes serovar. 0.3783 5 209
ID Description Score Start End Superfamily
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.599 31 212 1.10.1760.20
af_Q6Z868_94_278_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.533 11 221 1.10.1760.20
af_Q6Z868_94_278_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.524 11 221 1.10.1760.20
4hzuS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4948 31 212 1.10.1760.20
af_X1WEF3_56_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.4245 44 203 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A537S6W8-F1-model_v4 DUF2232 domain-containing protein 0.9729 1 84 GO:0016020
AF-A0A537S6W8-F1-model_v4 DUF2232 domain-containing protein 0.9297 1 84 GO:0016020
AF-A0A7V4Q7H8-F1-model_v4 DUF2232 domain-containing protein 0.9249 3 90 GO:0016020
AF-A0A1Q7B8Q8-F1-model_v4 DUF2232 domain-containing protein 0.9118 1 320 GO:0016020
AF-A0A1Q7B8Q8-F1-model_v4 DUF2232 domain-containing protein 0.906 1 320 GO:0016020

Map