F242916

General Info

Members Datasets Scaffolds Average Seq Length
164 129 328 309

Family's Representative Sequence

Representative Sequence 3300003203|JGI25406J46586_10036143|JGI25406J46586_100361432
Length 335
Sequence MASLRRLRKVFGAAYGDQVPGAPLSPMLATTGTLPRGPGWSYEFKWDGVRVISSFQGGPPQLFARSGTTVTTAYPEISGLXLPVGSMLDGEMVVLDAAGRPSFTSLAERMHVRDRVRAARLAAAHPVTYMIFDLLRYAGEDLMNLPYGLRRERLEDLELSGPHWMVPPVFQDGAATEAAARENRLEGVVAKRVDTAYTPGLRSPDWIKIKFDRTGDYVIGGWRSGARRLGGLLVGSPXPDGRLRFRGRVGGGISGASERELLSVLAPLDSPDSPFEPGAVPREDARGAHWVRPELVVEVRYGNRTPDGRLRFPRFLRLRPDKTPAECVEEDDDGA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
7 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
8 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
9 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
12 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
29 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
30 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
31 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
32 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
33 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
39 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
40 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
41 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
54 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
55 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
56 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
57 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
58 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
59 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
71 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
72 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
73 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
75 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
76 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
77 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
78 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
79 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
80 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
81 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
82 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
83 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
84 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
85 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
86 2501939600 Micromonospora sp. L5 Isolate Unclassified
87 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
88 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
89 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
90 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
91 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
92 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
93 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
94 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
95 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
96 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
97 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
98 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
99 2855683550 Micromonospora sp. RP3T Isolate Unclassified
100 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
101 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
102 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
103 2858868258 Micromonospora sp. MH33 Isolate Unclassified
104 2858882152 Micromonospora noduli MED15 Isolate Nodule
105 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
106 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
107 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
108 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
109 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
110 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
111 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
112 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
113 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
114 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
115 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
116 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
117 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
118 2902582711 Micromonospora sp. AP08 Isolate Unclassified
119 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
120 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
121 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
122 649633069 Micromonospora sp. L5 Isolate Unclassified
123 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
124 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
125 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
126 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
127 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
128 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
129 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.17
Metatranscriptomes 0
Isolates 26.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 3.66
Rhizoplane 1.22
Rhizosphere 64.02
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10036143 3300003203 Bacteria 1796
2 JGI25406J46586_10004980 3300003203 Bacteria 6171
3 Ga0070680_100457260 3300005336 Bacteria 1091
4 Ga0068868_100271185 3300005338 Bacteria 1434
5 Ga0070668_100000392 3300005347 Bacteria 29025
6 Ga0070667_100086956 3300005367 Bacteria 2682
7 Ga0068864_100292795 3300005618 Bacteria 1522
8 Ga0068863_100201127 3300005841 Bacteria 1916
9 Ga0068860_100014247 3300005843 Bacteria 7795
10 Ga0081540_1011680 3300005983 Bacteria 5851
11 Ga0081539_10000543 3300005985 Bacteria 77988
12 Ga0081539_10001533 3300005985 Bacteria 38679
13 Ga0081539_10001811 3300005985 Bacteria 33775
14 Ga0081539_10004065 3300005985 Bacteria 16734
15 Ga0081539_10010834 3300005985 Bacteria 7329
16 Ga0081539_10063244 3300005985 Bacteria 2020
17 Ga0081539_10074779 3300005985 Bacteria 1803
18 Ga0075428_100014549 3300006844 Bacteria 8739
19 Ga0075428_100211829 3300006844 Bacteria 2094
20 Ga0075428_100532746 3300006844 Bacteria 1256
21 Ga0075430_100001160 3300006846 Bacteria 21051
22 Ga0075430_100012541 3300006846 Bacteria 7215
23 Ga0075430_100027525 3300006846 Bacteria 4829
24 Ga0075430_100050807 3300006846 Bacteria 3495
25 Ga0075430_100055352 3300006846 Unclassified 3336
26 Ga0075431_100008701 3300006847 Bacteria 10169
27 Ga0075431_100221837 3300006847 Bacteria 1928
28 Ga0075431_100491098 3300006847 Bacteria 1220
29 Ga0075429_100008277 3300006880 Bacteria 9038
30 Ga0105240_10190767 3300009093 Bacteria 2410
31 Ga0114129_10000039 3300009147 Bacteria 108531
32 Ga0114129_10064577 3300009147 Bacteria 5109
33 Ga0157378_10075721 3300013297 Bacteria 3031
34 Ga0163163_10069612 3300014325 Bacteria 3503
35 Ga0157379_10160164 3300014968 Bacteria 2031
36 Ga0213876_10198921 3300021384 Bacteria 1065
37 Ga0207644_10097250 3300025931 Bacteria 2205
38 Ga0207689_10227726 3300025942 Bacteria 1541
39 Ga0207668_10001011 3300025972 Bacteria 16821
40 Ga0207658_10065860 3300025986 Bacteria 2723
41 Ga0207641_10044603 3300026088 Bacteria 3730
42 Ga0307515_10000038 3300028794 Bacteria 331376
43 Ga0307515_10003496 3300028794 Bacteria 33014
44 Ga0307515_10013248 3300028794 Bacteria 15423
45 Ga0307515_10071500 3300028794 Bacteria 4700
46 Ga0307512_10002589 3300030522 Bacteria 22473
47 Ga0307513_10014403 3300031456 Bacteria 9654
48 Ga0307513_10045791 3300031456 Bacteria 4777
49 Ga0307509_10040643 3300031507 Bacteria 5056
50 Ga0307508_10001840 3300031616 Bacteria 23465
51 Ga0307508_10002053 3300031616 Bacteria 21741
52 Ga0307516_10001251 3300031730 Bacteria 35348
53 Ga0307516_10006604 3300031730 Bacteria 13558
54 Ga0307413_10417628 3300031824 Bacteria 1056
55 Ga0326468_10000520 3300031889 Bacteria 4027
56 Ga0307407_10044235 3300031903 Bacteria 2508
57 Ga0307407_10196713 3300031903 Bacteria 1348
58 Ga0307411_10107001 3300032005 Bacteria 1992
59 Ga0307411_10183643 3300032005 Bacteria 1590
60 Ga0307415_100069677 3300032126 Bacteria 2467
61 Ga0307507_10090386 3300033179 Bacteria 2628
62 Ga0373951_0000119 3300035091 Bacteria 29709
63 Ga0373942_0001943 3300035207 Bacteria 5175
64 Ga0373962_0000333 3300035242 Bacteria 10323
65 Ga0373937_0214460 3300036401 Bacteria 1811
66 Ga0395899_0041322 3300037312 Bacteria 3446
67 Ga0395900_0062461 3300037418 Bacteria 3829
68 Ga0395900_0335613 3300037418 Bacteria 1488
69 Ga0395898_0015439 3300037466 Bacteria 7832
70 Ga0395905_0385777 3300037471 Bacteria 1295
71 Ga0395901_0003660 3300038443 Bacteria 15500
72 Ga0395901_0137733 3300038443 Bacteria 2565
73 Ga0436365_0400444 3300039437 Bacteria 2186
74 Ga0466961_0197726 3300044693 Bacteria 1244
75 Ga0466970_0008472 3300044765 Bacteria 5177
76 Ga0466959_0058461 3300045049 Bacteria 2808
77 Ga0451576_0280611 3300045051 Bacteria 1742
78 Ga0466967_0168572 3300045976 Bacteria 2059
79 Ga0495594_0131254 3300046499 Bacteria 1419
80 Ga0495632_0095791 3300046519 Bacteria 1402
81 Ga0496108_0001112 3300048911 Bacteria 21027
82 Ga0496111_0092440 3300048914 Bacteria 2217
83 Ga0496124_0065695 3300048927 Bacteria 3024
84 Ga0496126_0137939 3300048929 Bacteria 2102
85 Ga0501032_0102485 3300049569 Bacteria 1896
86 Ga0501033_0095720 3300049570 Bacteria 2170
87 Ga0501034_0006740 3300049571 Bacteria 12297
88 Ga0501034_0135270 3300049571 Bacteria 2446
89 Ga0501037_0016389 3300049573 Bacteria 5454
90 Ga0501038_0002009 3300049574 Bacteria 18781
91 Ga0501039_0060667 3300049575 Bacteria 2929
92 Ga0501040_0099989 3300049576 Bacteria 2022
93 Ga0501043_0023971 3300049579 Bacteria 4788
94 Ga0501043_0024826 3300049579 Bacteria 4703
95 Ga0501046_0006542 3300049580 Bacteria 10303
96 Ga0501046_0028393 3300049580 Bacteria 4556
97 Ga0501047_0025728 3300049581 Bacteria 5659
98 Ga0501047_0152900 3300049581 Bacteria 2182
99 Ga0501067_0081401 3300049583 Bacteria 1795
100 Ga0501073_0068896 3300049589 Bacteria 2466
101 Ga0501074_0048922 3300049590 Bacteria 3053
102 Ga0501083_0000859 3300049744 Bacteria 20012
103 Ga0501035_0064179 3300049822 Bacteria 3264
104 Ga0501044_0004577 3300049823 Bacteria 15468
105 Ga0501044_0133455 3300049823 Bacteria 2475
106 nmdc:mga05p37_1002_c1 3300050507 Bacteria 32202
107 nmdc:mga09592_4_c1 3300050508 Bacteria 133185
108 nmdc:mga0qj67_112701_c1 3300050509 Unclassified 2196
109 nmdc:mga0qj67_3_c2 3300050509 Bacteria 152036
110 nmdc:mga0qj67_4195_c1 3300050509 Bacteria 10441
111 nmdc:mga0qj67_483266_c1 3300050509 Bacteria 996
112 nmdc:mga06r32_184_c1 3300050510 Bacteria 45432
113 nmdc:mga06r32_275241_c1 3300050510 Bacteria 1671
114 Ga0500651_0161999 3300053093 Bacteria 1337
115 Ga0500641_0188402 3300053096 Bacteria 884
116 Ga0500556_0090750 3300053104 Bacteria 1166
117 Ga0500594_0004236 3300053118 Bacteria 3165
118 Ga0500652_004799 3300053131 Bacteria 4215
119 Ga0500579_070136 3300053143 Bacteria 2027
120 Ga0501082_0007395 3300060353 Bacteria 9478
121 2501942932 2501939600 Bacteria 6907073
122 2515496743 2515154088 Bacteria 5526283
123 2515718253 2515154129 Bacteria 5584369
124 2515759525 2515154137 Bacteria 5711575
125 2516083588 2515154202 Bacteria 5471270
126 2516089519 2515154203 Bacteria 5458536
127 2623586264 2622736626 Bacteria 7181580
128 2753269567 2751185782 Bacteria 11227053
129 2772641440 2772190715 Bacteria 6959372
130 2831937237 2831935698 Bacteria 5963223
131 2832010632 2832004796 Bacteria 6538017
132 2855676584 2855670206 Bacteria 7120389
133 2855683367 2855676851 Bacteria 7063653
134 2855685100 2855683550 Bacteria 7134265
135 2856860141 2856858025 Bacteria 7255264
136 2857292783 2857288857 Bacteria 7189066
137 2858852181 2858848962 Bacteria 6963058
138 2858870118 2858868258 Bacteria 7683772
139 2858888302 2858882152 Bacteria 7230291
140 2858892012 2858888857 Bacteria 7060307
141 2858899061 2858895516 Bacteria 7378898
142 2858905389 2858902515 Bacteria 7086037
143 2866068131 2866065130 Bacteria 6518152
144 2867304218 2867302475 Bacteria 7087181
145 2867313548 2867312974 Bacteria 7058875
146 2867322629 2867319477 Bacteria 7069771
147 2867509167 2867507094 Bacteria 6506033
148 2869049580 2869048445 Bacteria 6875584
149 2869064868 2869061728 Bacteria 7112407
150 2869073788 2869068681 Bacteria 7205615
151 2880494009 2880489317 Bacteria 7096270
152 2880498323 2880495981 Bacteria 7340502
153 2902587381 2902582711 Bacteria 6187705
154 2929220363 2929219909 Bacteria 6984360
155 2929226912 2929226422 Bacteria 7248583
156 2996223341 2996221748 Bacteria 6799777
157 649810624 649633069 Bacteria 6962533
158 8003834617 8003830390 Bacteria 6541657
159 8003857582 8003856774 Bacteria 7675274
160 8003876747 8003870546 Bacteria 7396674
161 8054710042 8054704163 Bacteria 7247792
162 8054728252 8054727385 Bacteria 7558670
163 8054735357 8054734606 Bacteria 6947278
164 8055413732 8055412473 Bacteria 6257500
165 JGI25406J46586_10036143
166 JGI25406J46586_10004980
167 Ga0070680_100457260
168 Ga0068868_100271185
169 Ga0070668_100000392
170 Ga0070667_100086956
171 Ga0068864_100292795
172 Ga0068863_100201127
173 Ga0068860_100014247
174 Ga0081540_1011680
175 Ga0081539_10000543
176 Ga0081539_10001533
177 Ga0081539_10001811
178 Ga0081539_10004065
179 Ga0081539_10010834
180 Ga0081539_10063244
181 Ga0081539_10074779
182 Ga0075428_100014549
183 Ga0075428_100211829
184 Ga0075428_100532746
185 Ga0075430_100001160
186 Ga0075430_100012541
187 Ga0075430_100027525
188 Ga0075430_100050807
189 Ga0075430_100055352
190 Ga0075431_100008701
191 Ga0075431_100221837
192 Ga0075431_100491098
193 Ga0075429_100008277
194 Ga0105240_10190767
195 Ga0114129_10000039
196 Ga0114129_10064577
197 Ga0157378_10075721
198 Ga0163163_10069612
199 Ga0157379_10160164
200 Ga0213876_10198921
201 Ga0207644_10097250
202 Ga0207689_10227726
203 Ga0207668_10001011
204 Ga0207658_10065860
205 Ga0207641_10044603
206 Ga0307515_10000038
207 Ga0307515_10003496
208 Ga0307515_10013248
209 Ga0307515_10071500
210 Ga0307512_10002589
211 Ga0307513_10014403
212 Ga0307513_10045791
213 Ga0307509_10040643
214 Ga0307508_10001840
215 Ga0307508_10002053
216 Ga0307516_10001251
217 Ga0307516_10006604
218 Ga0307413_10417628
219 Ga0326468_10000520
220 Ga0307407_10044235
221 Ga0307407_10196713
222 Ga0307411_10107001
223 Ga0307411_10183643
224 Ga0307415_100069677
225 Ga0307507_10090386
226 Ga0373951_0000119
227 Ga0373942_0001943
228 Ga0373962_0000333
229 Ga0373937_0214460
230 Ga0395899_0041322
231 Ga0395900_0062461
232 Ga0395900_0335613
233 Ga0395898_0015439
234 Ga0395905_0385777
235 Ga0395901_0003660
236 Ga0395901_0137733
237 Ga0436365_0400444
238 Ga0466961_0197726
239 Ga0466970_0008472
240 Ga0466959_0058461
241 Ga0451576_0280611
242 Ga0466967_0168572
243 Ga0495594_0131254
244 Ga0495632_0095791
245 Ga0496108_0001112
246 Ga0496111_0092440
247 Ga0496124_0065695
248 Ga0496126_0137939
249 Ga0501032_0102485
250 Ga0501033_0095720
251 Ga0501034_0006740
252 Ga0501034_0135270
253 Ga0501037_0016389
254 Ga0501038_0002009
255 Ga0501039_0060667
256 Ga0501040_0099989
257 Ga0501043_0023971
258 Ga0501043_0024826
259 Ga0501046_0006542
260 Ga0501046_0028393
261 Ga0501047_0025728
262 Ga0501047_0152900
263 Ga0501067_0081401
264 Ga0501073_0068896
265 Ga0501074_0048922
266 Ga0501083_0000859
267 Ga0501035_0064179
268 Ga0501044_0004577
269 Ga0501044_0133455
270 nmdc:mga05p37_1002_c1
271 nmdc:mga09592_4_c1
272 nmdc:mga0qj67_112701_c1
273 nmdc:mga0qj67_3_c2
274 nmdc:mga0qj67_4195_c1
275 nmdc:mga0qj67_483266_c1
276 nmdc:mga06r32_184_c1
277 nmdc:mga06r32_275241_c1
278 Ga0500651_0161999
279 Ga0500641_0188402
280 Ga0500556_0090750
281 Ga0500594_0004236
282 Ga0500652_004799
283 Ga0500579_070136
284 Ga0501082_0007395
285 2501942932
286 2515496743
287 2515718253
288 2515759525
289 2516083588
290 2516089519
291 2623586264
292 2753269567
293 2772641440
294 2831937237
295 2832010632
296 2855676584
297 2855683367
298 2855685100
299 2856860141
300 2857292783
301 2858852181
302 2858870118
303 2858888302
304 2858892012
305 2858899061
306 2858905389
307 2866068131
308 2867304218
309 2867313548
310 2867322629
311 2867509167
312 2869049580
313 2869064868
314 2869073788
315 2880494009
316 2880498323
317 2902587381
318 2929220363
319 2929226912
320 2996223341
321 649810624
322 8003834617
323 8003857582
324 8003876747
325 8054710042
326 8054728252
327 8054735357
328 8055413732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04679

DNA_ligase_A_C

ATP dependent DNA ligase C terminal region

225

322

0.95

PF01068

DNA_ligase_A_M

ATP dependent DNA ligase domain

26

210

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rpw-assembly1.cif.gz_E archaeal dna ligase and heterotrimeric pcna in complex with adenylated dna 0.8421 7 199
7sx5-assembly1.cif.gz_A crystal structure of ligase i with nick duplexes containing mismatch a:c 0.7165 7 314
6p0a-assembly1.cif.gz_A human dna ligase 1 bound to an adenylated, dideoxy terminated dna nick with 2 mm mg2+ 0.7048 7 314
7l35-assembly1.cif.gz_A human dna ligase 1 - r771w nicked dna complex 0.7034 7 314
7kr3-assembly1.cif.gz_A human dna ligase 1(e346a/e592a) bound to a bulged dna substrate 0.6987 7 314
ID Description Score Start End Superfamily
af_P9WNV3_639_759_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9362 201 317 2.40.50.140
af_L0TDE1_8_201_3.30.470.30 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9138 9 198 3.30.470.30
1vs0B02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;DNA ligase/mRNA capping enzyme 0.9064 35 146 3.30.470.30
af_P9WNV3_639_759_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8992 201 317 2.40.50.140
1vs0B01 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.8977 159 199 3.30.1490.70
ID Description Score Start End GO Terms
AF-A0A6N7IGA4-F1-model_v4 DNA ligase 0.9823 10 198 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A3B8XC98-F1-model_v4 DNA ligase 0.9794 10 198 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A3B9MCD1-F1-model_v4 DNA ligase 0.9793 10 198 GO:0003910
GO:0005524
GO:0006281
GO:0006310
AF-A0A376EGU7-F1-model_v4 deleted 0.9759 13 187
AF-A0A6N7GCB2-F1-model_v4 ATP-dependent DNA ligase 0.9758 10 198 GO:0003910
GO:0005524
GO:0006281
GO:0006310

Map