F242235

General Info

Members Datasets Scaffolds Average Seq Length
163 87 326 348

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0004357|Ga0453684_0004357_9528_10706
Length 392
Sequence MGFRPHPYFSAQSGRAVRPGYQIQKNLQFFNKVIMLQFLTRRLLMLIPVLLGILVVTFTITRMVPGDPCLVIMGEKATPQQCQAFRERFGLDKSIPEQFVRYMGNIATGDFGKSIQQSRPVTDMIAERLPMTIELTVGAMIFSTIAGLLLGLASALKRNSILDVVTMIIANIGVSMPVYWLGLMLAYVFSLMLKGTAFYIPPSGRFSAGISLIPLATTWGMTDLTGFGKFAISFLSNLAIFNGLVTGNFKLVRDTLWHLILPCLAVGTIPMAVIARMTRSSLLDVLGQDYVRTARAKGLINRKVITKHAMRNALIPIITIIGVETGVLLSGAVLTETIFALPGIGTAMVNAIFARDYPVIQGFTIMVGFIFVIVNLIVDISYAYLDPRIRLE

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
27 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
39 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
43 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
44 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
45 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
48 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
49 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
50 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
51 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
52 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
53 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
54 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
57 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
58 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
59 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
60 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
61 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
63 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
64 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
71 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
77 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
78 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
79 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
80 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
82 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
83 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
84 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
85 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
86 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
87 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 4.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0004357 3300044712 Bacteria 30033
2 SwRhRL2b_contig_1937454 2162886007 Bacteria 4099
3 JGI25406J46586_10012405 3300003203 Bacteria 3701
4 JGI25406J46586_10017837 3300003203 Bacteria 2926
5 Ga0065707_10000518 3300005295 Bacteria 31549
6 Ga0065707_10084389 3300005295 Bacteria 7264
7 Ga0065707_10088126 3300005295 Bacteria 4767
8 Ga0065707_10100637 3300005295 Bacteria 2903
9 Ga0070680_100097175 3300005336 Bacteria 2442
10 Ga0070689_100156781 3300005340 Unclassified 1838
11 Ga0070681_10071293 3300005458 Bacteria 3439
12 Ga0070707_100041237 3300005468 Bacteria 4418
13 Ga0070707_100169405 3300005468 Bacteria 2128
14 Ga0070698_100008663 3300005471 Bacteria 10961
15 Ga0070698_100048501 3300005471 Unclassified 4339
16 Ga0070698_100068611 3300005471 Bacteria 3563
17 Ga0070699_100002819 3300005518 Bacteria 15510
18 Ga0070696_100127518 3300005546 Bacteria 1848
19 Ga0070704_100066056 3300005549 Bacteria 2607
20 Ga0068859_100025362 3300005617 Bacteria 5948
21 Ga0068859_100148196 3300005617 Bacteria 2422
22 Ga0068864_100127308 3300005618 Bacteria 2284
23 Ga0068861_100121246 3300005719 Bacteria 2110
24 Ga0068862_100174725 3300005844 Bacteria 1925
25 Ga0068862_100280346 3300005844 Bacteria 1527
26 Ga0081539_10007112 3300005985 Bacteria 10344
27 Ga0081539_10010761 3300005985 Bacteria 7367
28 Ga0075427_10000406 3300006194 Bacteria 4862
29 Ga0075428_100022960 3300006844 Bacteria 6905
30 Ga0075428_100119651 3300006844 Bacteria 2867
31 Ga0075431_100167686 3300006847 Bacteria 2257
32 Ga0075433_10011190 3300006852 Bacteria 7217
33 Ga0075429_100001339 3300006880 Bacteria 20118
34 Ga0075429_100044892 3300006880 Bacteria 3844
35 Ga0075429_100245155 3300006880 Bacteria 1569
36 Ga0097620_100025361 3300006931 Bacteria 5948
37 Ga0097620_100148196 3300006931 Bacteria 2422
38 Ga0105245_10127773 3300009098 Bacteria 2381
39 Ga0114129_10003890 3300009147 Bacteria 21062
40 Ga0114129_10010385 3300009147 Bacteria 13281
41 Ga0114129_10083124 3300009147 Bacteria 4449
42 Ga0114129_10126617 3300009147 Bacteria 3511
43 Ga0105242_10016980 3300009176 Bacteria 5666
44 Ga0105249_10008404 3300009553 Bacteria 8994
45 Ga0105249_10034050 3300009553 Bacteria 4614
46 Ga0105246_10006799 3300011119 Bacteria 6991
47 Ga0105246_10270536 3300011119 Bacteria 1358
48 Ga0207646_10015450 3300025922 Bacteria 7209
49 Ga0207646_10057345 3300025922 Bacteria 3480
50 Ga0207686_10013471 3300025934 Bacteria 4526
51 Ga0207712_10057788 3300025961 Bacteria 2738
52 Ga0207676_10044435 3300026095 Unclassified 3428
53 Ga0207675_100165528 3300026118 Bacteria 2111
54 Ga0209983_1013504 3300027665 Bacteria 1679
55 Ga0209966_1012551 3300027695 Bacteria 1558
56 Ga0209998_10000033 3300027717 Bacteria 58970
57 Ga0209974_10000253 3300027876 Bacteria 17349
58 Ga0316576_10131057 3300031727 Bacteria 1886
59 Ga0316576_10134180 3300031727 Bacteria 1863
60 Ga0316578_10203662 3300031728 Unclassified 1191
61 Ga0307416_100249641 3300032002 Unclassified 1726
62 Ga0316586_1008500 3300033527 Bacteria 1523
63 Ga0373924_0045036 3300035410 Bacteria 1814
64 Ga0373935_0181977 3300035692 Bacteria 1444
65 Ga0373927_0186105 3300035695 Bacteria 1362
66 Ga0373947_0012851 3300035725 Bacteria 4799
67 Ga0373937_0002765 3300036401 Bacteria 14641
68 Ga0373925_0008769 3300037068 Bacteria 7366
69 Ga0450910_004560 3300042147 Bacteria 1871
70 Ga0451577_0000534 3300042876 Bacteria 62557
71 Ga0451577_0068366 3300042876 Bacteria 3168
72 Ga0451577_0080214 3300042876 Unclassified 2910
73 Ga0451577_0437185 3300042876 Bacteria 1188
74 Ga0451577_0557884 3300042876 Bacteria 1040
75 Ga0453683_0010883 3300044673 Bacteria 6014
76 Ga0453683_0077812 3300044673 Bacteria 2077
77 Ga0453683_0083119 3300044673 Bacteria 2006
78 Ga0453683_0085962 3300044673 Bacteria 1970
79 Ga0453684_0000074 3300044712 Bacteria 438364
80 Ga0453684_0000164 3300044712 Bacteria 296093
81 Ga0453684_0003227 3300044712 Bacteria 37327
82 Ga0453684_0003726 3300044712 Bacteria 33749
83 Ga0453684_0003946 3300044712 Bacteria 32470
84 Ga0453684_0008203 3300044712 Bacteria 18834
85 Ga0453684_0008222 3300044712 Bacteria 18811
86 Ga0453684_0009066 3300044712 Bacteria 17554
87 Ga0453684_0010507 3300044712 Bacteria 15815
88 Ga0453684_0010742 3300044712 Bacteria 15555
89 Ga0453684_0038949 3300044712 Bacteria 6485
90 Ga0453684_0039227 3300044712 Bacteria 6458
91 Ga0453684_0041974 3300044712 Bacteria 6174
92 Ga0453684_0084056 3300044712 Bacteria 3960
93 Ga0453684_0093833 3300044712 Bacteria 3695
94 Ga0453684_0121230 3300044712 Bacteria 3157
95 Ga0453684_0157464 3300044712 Bacteria 2691
96 Ga0453684_0204687 3300044712 Bacteria 2298
97 Ga0453684_0264314 3300044712 Bacteria 1969
98 Ga0453684_0279763 3300044712 Bacteria 1903
99 Ga0453684_0280086 3300044712 Bacteria 1902
100 Ga0453684_0325513 3300044712 Bacteria 1739
101 Ga0453684_0356304 3300044712 Bacteria 1648
102 Ga0453684_0451261 3300044712 Unclassified 1431
103 Ga0453684_0498499 3300044712 Bacteria 1349
104 Ga0451576_0000263 3300045051 Bacteria 128339
105 Ga0451576_0002271 3300045051 Bacteria 29333
106 Ga0451576_0004433 3300045051 Bacteria 18245
107 Ga0451576_0086491 3300045051 Bacteria 3260
108 Ga0451576_0337285 3300045051 Bacteria 1578
109 Ga0495651_0111955 3300046462 Bacteria 2017
110 Ga0495653_0068008 3300046463 Bacteria 2673
111 Ga0495608_0047412 3300046511 Bacteria 2857
112 Ga0495628_0025106 3300046516 Bacteria 4872
113 Ga0495667_0023371 3300046559 Bacteria 4165
114 Ga0495657_0202429 3300046675 Bacteria 1209
115 Ga0495680_0027678 3300047322 Bacteria 4653
116 Ga0496102_0371550 3300048905 Bacteria 1346
117 Ga0496104_0113084 3300048907 Bacteria 2604
118 Ga0501034_0049389 3300049571 Bacteria 4244
119 Ga0501038_0233531 3300049574 Bacteria 1462
120 Ga0501039_0171755 3300049575 Bacteria 1704
121 Ga0501040_0084427 3300049576 Bacteria 2203
122 Ga0501040_0097081 3300049576 Bacteria 2052
123 Ga0501041_0024159 3300049577 Bacteria 3647
124 Ga0501042_0047529 3300049578 Bacteria 3060
125 Ga0501043_0110007 3300049579 Bacteria 2164
126 Ga0501047_0049340 3300049581 Bacteria 4064
127 Ga0501048_0092720 3300049582 Bacteria 2130
128 Ga0501067_0035921 3300049583 Bacteria 2752
129 Ga0501068_0018179 3300049584 Bacteria 4070
130 Ga0501070_0122571 3300049586 Bacteria 2148
131 Ga0501071_0005587 3300049587 Bacteria 8102
132 Ga0501071_0121208 3300049587 Bacteria 1938
133 Ga0501071_0124750 3300049587 Bacteria 1910
134 Ga0501071_0164673 3300049587 Bacteria 1659
135 Ga0501072_0029579 3300049588 Bacteria 4281
136 Ga0501072_0042233 3300049588 Bacteria 3582
137 Ga0501072_0144710 3300049588 Bacteria 1895
138 Ga0501072_0222161 3300049588 Bacteria 1505
139 Ga0501073_0051617 3300049589 Bacteria 2880
140 Ga0501074_0006436 3300049590 Bacteria 8481
141 Ga0501074_0194919 3300049590 Bacteria 1444
142 Ga0501076_0029072 3300049592 Bacteria 4296
143 Ga0501076_0158129 3300049592 Bacteria 1845
144 Ga0501079_0053637 3300049741 Bacteria 3110
145 Ga0501083_0035544 3300049744 Bacteria 3402
146 Ga0501044_0073803 3300049823 Bacteria 3467
147 Ga0501045_0058261 3300049824 Bacteria 2828
148 Ga0501045_0090876 3300049824 Bacteria 2256
149 Ga0501045_0216729 3300049824 Bacteria 1425
150 nmdc:mga05p37_14854_c1 3300050507 Bacteria 9352
151 nmdc:mga05p37_357261_c1 3300050507 Bacteria 1719
152 nmdc:mga05p37_3971_c1 3300050507 Bacteria 17316
153 nmdc:mga09592_15882_c1 3300050508 Unclassified 1334
154 nmdc:mga09592_221720_c1 3300050508 Bacteria 1638
155 nmdc:mga09592_23700_c1 3300050508 Bacteria 5070
156 nmdc:mga09592_455_c2 3300050508 Bacteria 27552
157 nmdc:mga09592_72732_c1 3300050508 Bacteria 2920
158 nmdc:mga0qj67_461829_c1 3300050509 Archaea 1022
159 nmdc:mga06r32_62230_c1 3300050510 Bacteria 3595
160 nmdc:mga0a205_19953_c1 3300050515 Bacteria 6324
161 nmdc:mga0a205_4088_c1 3300050515 Bacteria 13053
162 Ga0530510_0030957 3300061734 Bacteria 3845
163 Ga0530510_0061660 3300061734 Bacteria 2715
164 Ga0453684_0004357
165 SwRhRL2b_contig_1937454
166 JGI25406J46586_10012405
167 JGI25406J46586_10017837
168 Ga0065707_10000518
169 Ga0065707_10084389
170 Ga0065707_10088126
171 Ga0065707_10100637
172 Ga0070680_100097175
173 Ga0070689_100156781
174 Ga0070681_10071293
175 Ga0070707_100041237
176 Ga0070707_100169405
177 Ga0070698_100008663
178 Ga0070698_100048501
179 Ga0070698_100068611
180 Ga0070699_100002819
181 Ga0070696_100127518
182 Ga0070704_100066056
183 Ga0068859_100025362
184 Ga0068859_100148196
185 Ga0068864_100127308
186 Ga0068861_100121246
187 Ga0068862_100174725
188 Ga0068862_100280346
189 Ga0081539_10007112
190 Ga0081539_10010761
191 Ga0075427_10000406
192 Ga0075428_100022960
193 Ga0075428_100119651
194 Ga0075431_100167686
195 Ga0075433_10011190
196 Ga0075429_100001339
197 Ga0075429_100044892
198 Ga0075429_100245155
199 Ga0097620_100025361
200 Ga0097620_100148196
201 Ga0105245_10127773
202 Ga0114129_10003890
203 Ga0114129_10010385
204 Ga0114129_10083124
205 Ga0114129_10126617
206 Ga0105242_10016980
207 Ga0105249_10008404
208 Ga0105249_10034050
209 Ga0105246_10006799
210 Ga0105246_10270536
211 Ga0207646_10015450
212 Ga0207646_10057345
213 Ga0207686_10013471
214 Ga0207712_10057788
215 Ga0207676_10044435
216 Ga0207675_100165528
217 Ga0209983_1013504
218 Ga0209966_1012551
219 Ga0209998_10000033
220 Ga0209974_10000253
221 Ga0316576_10131057
222 Ga0316576_10134180
223 Ga0316578_10203662
224 Ga0307416_100249641
225 Ga0316586_1008500
226 Ga0373924_0045036
227 Ga0373935_0181977
228 Ga0373927_0186105
229 Ga0373947_0012851
230 Ga0373937_0002765
231 Ga0373925_0008769
232 Ga0450910_004560
233 Ga0451577_0000534
234 Ga0451577_0068366
235 Ga0451577_0080214
236 Ga0451577_0437185
237 Ga0451577_0557884
238 Ga0453683_0010883
239 Ga0453683_0077812
240 Ga0453683_0083119
241 Ga0453683_0085962
242 Ga0453684_0000074
243 Ga0453684_0000164
244 Ga0453684_0003227
245 Ga0453684_0003726
246 Ga0453684_0003946
247 Ga0453684_0008203
248 Ga0453684_0008222
249 Ga0453684_0009066
250 Ga0453684_0010507
251 Ga0453684_0010742
252 Ga0453684_0038949
253 Ga0453684_0039227
254 Ga0453684_0041974
255 Ga0453684_0084056
256 Ga0453684_0093833
257 Ga0453684_0121230
258 Ga0453684_0157464
259 Ga0453684_0204687
260 Ga0453684_0264314
261 Ga0453684_0279763
262 Ga0453684_0280086
263 Ga0453684_0325513
264 Ga0453684_0356304
265 Ga0453684_0451261
266 Ga0453684_0498499
267 Ga0451576_0000263
268 Ga0451576_0002271
269 Ga0451576_0004433
270 Ga0451576_0086491
271 Ga0451576_0337285
272 Ga0495651_0111955
273 Ga0495653_0068008
274 Ga0495608_0047412
275 Ga0495628_0025106
276 Ga0495667_0023371
277 Ga0495657_0202429
278 Ga0495680_0027678
279 Ga0496102_0371550
280 Ga0496104_0113084
281 Ga0501034_0049389
282 Ga0501038_0233531
283 Ga0501039_0171755
284 Ga0501040_0084427
285 Ga0501040_0097081
286 Ga0501041_0024159
287 Ga0501042_0047529
288 Ga0501043_0110007
289 Ga0501047_0049340
290 Ga0501048_0092720
291 Ga0501067_0035921
292 Ga0501068_0018179
293 Ga0501070_0122571
294 Ga0501071_0005587
295 Ga0501071_0121208
296 Ga0501071_0124750
297 Ga0501071_0164673
298 Ga0501072_0029579
299 Ga0501072_0042233
300 Ga0501072_0144710
301 Ga0501072_0222161
302 Ga0501073_0051617
303 Ga0501074_0006436
304 Ga0501074_0194919
305 Ga0501076_0029072
306 Ga0501076_0158129
307 Ga0501079_0053637
308 Ga0501083_0035544
309 Ga0501044_0073803
310 Ga0501045_0058261
311 Ga0501045_0090876
312 Ga0501045_0216729
313 nmdc:mga05p37_14854_c1
314 nmdc:mga05p37_357261_c1
315 nmdc:mga05p37_3971_c1
316 nmdc:mga09592_15882_c1
317 nmdc:mga09592_221720_c1
318 nmdc:mga09592_23700_c1
319 nmdc:mga09592_455_c2
320 nmdc:mga09592_72732_c1
321 nmdc:mga0qj67_461829_c1
322 nmdc:mga06r32_62230_c1
323 nmdc:mga0a205_19953_c1
324 nmdc:mga0a205_4088_c1
325 Ga0530510_0030957
326 Ga0530510_0061660

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

147

391

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

35

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7759 98 349
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7634 87 349
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7594 98 342
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7532 87 352
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7487 98 345
ID Description Score Start End Superfamily
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9524 98 353 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9501 86 353 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9459 86 353 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9404 87 350 1.10.3720.10
af_Q2FVE8_90_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.939 93 350 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7C6PVU6-F1-model_v4 Nickel import system permease protein NikB 0.9652 1 357 GO:0005886
GO:0015099
AF-A0A4V6YB74-F1-model_v4 ABC transporter permease 0.9633 1 358 GO:0005886
GO:0055085
AF-A0A3E0KMX5-F1-model_v4 Nickel import system permease protein NikB 0.9625 1 358 GO:0005886
GO:0015099
AF-A0A6L5B746-F1-model_v4 deleted 0.962 2 359
AF-A0A2D6JEJ5-F1-model_v4 Glutathione ABC transporter permease GsiC 0.96 1 359 GO:0005886
GO:0015099

Map