F242101

General Info

Members Datasets Scaffolds Average Seq Length
163 114 161 261

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0056714|Ga0395905_0056714_53_919
Length 288
Sequence MYLDLPGNPSEKRTNSVNCQHKFSSSKPDSMKKKLLFLGCSSLVISLAMAQQKPKPEDTEFYTPVPPVVDPGKPGCGVPSDAVVLFDGTGLDQWVSAGDSTKPAGWDLVNGVMRVNKKAGDIRTRRSFTDYQLHIEWRVPENITGSGQARGNSGIFLASVFDGGYELQVLDSYNNKTYTNGQAGSMYKQYVPLANPMRPPGEWQVYDVVWTAPRFKADGSLEAPARVTTFLNGVLVQNNVALRGRTEYIGQPSYKAHGPAPIKLQAHGDPSEPISYRNIWVRPLQAWQ

Samples

Sample ID Description Type Environment
1 2738543009 Luteibacter sp. OK325 Isolate Unclassified
2 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
72 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
73 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
85 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
101 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
102 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
103 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
109 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
110 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
111 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
112 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.27
Nodule 0
Rhizoplane 3.68
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 4.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1013005 3300001915 Bacteria 1418
2 Ga0055530_10000044 3300003791 Bacteria 110073
3 Ga0055530_10004019 3300003791 Bacteria 7909
4 Ga0055531_10000072 3300003794 Bacteria 110069
5 Ga0055531_10023274 3300003794 Unclassified 2330
6 Ga0055543_1009424 3300004625 Bacteria 2097
7 Ga0065165_1001146 3300005262 Bacteria 30997
8 Ga0070658_10127930 3300005327 Unclassified 2115
9 Ga0070658_10489049 3300005327 Bacteria 1062
10 Ga0070683_100071195 3300005329 Bacteria 3244
11 Ga0070683_100550768 3300005329 Bacteria 1103
12 Ga0070680_100004162 3300005336 Bacteria 10842
13 Ga0070680_100018921 3300005336 Bacteria 5449
14 Ga0070682_100002262 3300005337 Bacteria 10665
15 Ga0070660_100000329 3300005339 Bacteria 31290
16 Ga0070660_100069984 3300005339 Bacteria 2737
17 Ga0070691_10001884 3300005341 Bacteria 9179
18 Ga0070691_10003790 3300005341 Bacteria 6833
19 Ga0070661_100030362 3300005344 Bacteria 3903
20 Ga0070671_100188733 3300005355 Bacteria 1747
21 Ga0070659_100001580 3300005366 Bacteria 16403
22 Ga0070659_100014105 3300005366 Bacteria 5963
23 Ga0070714_100036203 3300005435 Unclassified 4139
24 Ga0070714_100214460 3300005435 Bacteria 1766
25 Ga0070681_10008549 3300005458 Bacteria 10028
26 Ga0070681_10022745 3300005458 Bacteria 6300
27 Ga0068867_100189577 3300005459 Bacteria 1640
28 Ga0070699_100202816 3300005518 Bacteria 1764
29 Ga0070679_100010375 3300005530 Bacteria 8834
30 Ga0070679_100024759 3300005530 Bacteria 5883
31 Ga0068853_100028442 3300005539 Bacteria 4702
32 Ga0068853_100071106 3300005539 Bacteria 3029
33 Ga0070665_100063960 3300005548 Bacteria 3689
34 Ga0068855_100006117 3300005563 Bacteria 14683
35 Ga0068855_100050535 3300005563 Bacteria 4899
36 Ga0068857_100076947 3300005577 Bacteria 2976
37 Ga0068856_100053324 3300005614 Bacteria 3987
38 Ga0068856_100131960 3300005614 Bacteria 2503
39 Ga0075367_10132862 3300006178 Bacteria 1539
40 Ga0075430_100156654 3300006846 Bacteria 1896
41 Ga0075433_10037431 3300006852 Bacteria 4186
42 Ga0075429_100282787 3300006880 Bacteria 1453
43 Ga0075436_100002862 3300006914 Bacteria 11817
44 Ga0105240_10006381 3300009093 Bacteria 17361
45 Ga0105240_10011271 3300009093 Bacteria 12464
46 Ga0105240_10050599 3300009093 Bacteria 5236
47 Ga0114129_10130892 3300009147 Bacteria 3446
48 Ga0105241_10339675 3300009174 Bacteria 1301
49 Ga0105237_10000169 3300009545 Bacteria 92124
50 Ga0105237_10049947 3300009545 Bacteria 4203
51 Ga0105238_10081547 3300009551 Bacteria 3224
52 Ga0105238_10116643 3300009551 Bacteria 2650
53 Ga0105238_10298171 3300009551 Bacteria 1595
54 Ga0157370_10006874 3300013104 Bacteria 12456
55 Ga0157370_10167169 3300013104 Bacteria 2045
56 Ga0157370_10261508 3300013104 Bacteria 1599
57 Ga0157369_10028083 3300013105 Bacteria 6230
58 Ga0157369_10281184 3300013105 Bacteria 1733
59 Ga0163162_10219050 3300013306 Bacteria 2033
60 Ga0157372_10034828 3300013307 Bacteria 5540
61 Ga0157372_10102076 3300013307 Bacteria 3276
62 Ga0157372_10113382 3300013307 Bacteria 3107
63 Ga0157372_10191067 3300013307 Bacteria 2372
64 Ga0157375_10182586 3300013308 Bacteria 2250
65 Ga0163163_10057186 3300014325 Bacteria 3856
66 Ga0213872_10001301 3300021361 Bacteria 16637
67 Ga0209233_1040127 3300025261 Bacteria 1021
68 Ga0209758_1013392 3300025297 Bacteria 4474
69 Ga0209050_1000014 3300025298 Bacteria 774327
70 Ga0209050_1000053 3300025298 Bacteria 349521
71 Ga0209257_1000019 3300025304 Bacteria 774261
72 Ga0209257_1002095 3300025304 Bacteria 20972
73 Ga0209257_1009170 3300025304 Bacteria 5379
74 Ga0207647_10119554 3300025904 Bacteria 1554
75 Ga0207705_10386290 3300025909 Bacteria 1082
76 Ga0207707_10003273 3300025912 Bacteria 14387
77 Ga0207707_10011273 3300025912 Bacteria 7781
78 Ga0207707_10018446 3300025912 Bacteria 6084
79 Ga0207695_10019086 3300025913 Bacteria 7908
80 Ga0207695_10027690 3300025913 Bacteria 6307
81 Ga0207695_10082102 3300025913 Bacteria 3260
82 Ga0207671_10086999 3300025914 Bacteria 2349
83 Ga0207671_10149327 3300025914 Bacteria 1805
84 Ga0207660_10005032 3300025917 Bacteria 8615
85 Ga0207660_10125014 3300025917 Bacteria 1952
86 Ga0207657_10001028 3300025919 Bacteria 29581
87 Ga0207657_10107937 3300025919 Bacteria 2302
88 Ga0207657_10187148 3300025919 Bacteria 1672
89 Ga0207649_10090980 3300025920 Bacteria 1998
90 Ga0207652_10002041 3300025921 Bacteria 17365
91 Ga0207694_10032905 3300025924 Bacteria 3972
92 Ga0207664_10018226 3300025929 Bacteria 5162
93 Ga0207664_10189237 3300025929 Bacteria 1771
94 Ga0207690_10001660 3300025932 Bacteria 13755
95 Ga0207669_10089862 3300025937 Bacteria 1996
96 Ga0207691_10238510 3300025940 Bacteria 1573
97 Ga0207667_10006749 3300025949 Bacteria 13854
98 Ga0207651_10534491 3300025960 Bacteria 1018
99 Ga0207640_10069712 3300025981 Bacteria 2362
100 Ga0207639_10080348 3300026041 Bacteria 2579
101 Ga0207674_10010954 3300026116 Bacteria 10206
102 Ga0268266_10212323 3300028379 Bacteria 1775
103 Ga0307517_10012770 3300028786 Bacteria 11486
104 Ga0307515_10219799 3300028794 Bacteria 1721
105 Ga0265325_10085828 3300031241 Bacteria 1559
106 Ga0307513_10000414 3300031456 Bacteria 61908
107 Ga0307513_10310549 3300031456 Bacteria 1339
108 Ga0265313_10093092 3300031595 Bacteria 1349
109 Ga0395899_0068363 3300037312 Bacteria 2605
110 Ga0395900_0007990 3300037418 Bacteria 10887
111 Ga0395900_0204202 3300037418 Bacteria 1998
112 Ga0395898_0307007 3300037466 Bacteria 1513
113 Ga0395905_0000565 3300037471 Bacteria 50339
114 Ga0395905_0056714 3300037471 Bacteria 3664
115 Ga0395905_0060679 3300037471 Bacteria 3536
116 Ga0395905_0275468 3300037471 Bacteria 1568
117 Ga0436364_0349745 3300037853 Unclassified 1895
118 Ga0436361_0829477 3300039447 Bacteria 18889
119 Ga0436363_0275130 3300039450 Unclassified 1155
120 Ga0466959_0307708 3300045049 Bacteria 1084
121 Ga0495650_0065475 3300046471 Bacteria 1442
122 Ga0495610_0000029 3300046512 Bacteria 271137
123 Ga0495610_0000810 3300046512 Bacteria 29316
124 Ga0495628_0483871 3300046516 Bacteria 895
125 Ga0495668_0190957 3300046616 Bacteria 1122
126 Ga0495611_0000761 3300046648 Bacteria 18065
127 Ga0495611_0059738 3300046648 Bacteria 1731
128 Ga0495625_0001967 3300046660 Bacteria 23187
129 Ga0495669_0045999 3300046684 Bacteria 1947
130 Ga0495672_0070687 3300047320 Bacteria 1977
131 Ga0496101_0112069 3300048904 Bacteria 2055
132 Ga0496106_0231049 3300048909 Bacteria 1477
133 Ga0496108_0185585 3300048911 Bacteria 1802
134 Ga0496109_0152570 3300048912 Bacteria 2163
135 Ga0496112_0073628 3300048915 Bacteria 3377
136 Ga0496112_0219320 3300048915 Bacteria 1858
137 Ga0501034_0167962 3300049571 Unclassified 2162
138 Ga0501034_0311715 3300049571 Bacteria 1508
139 Ga0501047_0001868 3300049581 Bacteria 20268
140 Ga0501047_0035095 3300049581 Bacteria 4844
141 Ga0501047_0290677 3300049581 Bacteria 1478
142 Ga0501048_0154952 3300049582 Unclassified 1621
143 Ga0501069_0011964 3300049585 Bacteria 4605
144 Ga0501072_0314668 3300049588 Bacteria 1244
145 Ga0501074_0121658 3300049590 Unclassified 1867
146 Ga0501241_002160 3300049758 Bacteria 3843
147 Ga0501241_005227 3300049758 Bacteria 2422
148 Ga0501044_0033273 3300049823 Bacteria 5418
149 nmdc:mga06z11_107457_c1 3300050494 Bacteria 1540
150 nmdc:mga05p37_5569_c1 3300050507 Bacteria 14808
151 nmdc:mga09592_364352_c1 3300050508 Bacteria 1250
152 nmdc:mga08y16_899956_c1 3300050511 Bacteria 871
153 nmdc:mga08x19_42285_c1 3300050514 Bacteria 2904
154 nmdc:mga0a205_87529_c2 3300050515 Bacteria 1875
155 Ga0500578_0000008 3300053086 Bacteria 223557
156 Ga0500555_007211 3300053103 Bacteria 3160
157 Ga0500562_003631 3300053108 Bacteria 3876
158 Ga0500594_0000110 3300053118 Bacteria 24013
159 Ga0500645_000115 3300053730 Bacteria 64208
160 Ga0501084_0029845 3300054114 Bacteria 4560
161 Ga0501082_0539096 3300060353 Bacteria 1020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300060353 Ga0501082_0539096 Ga0501082_0539096_20_682 217
2 3300045049 Ga0466959_0307708 Ga0466959_0307708_406_1065 219
3 3300005518 Ga0070699_100202816 Ga0070699_1002028161 228
4 3300049571 Ga0501034_0311715 Ga0501034_0311715_697_1482 237
5 3300005355 Ga0070671_100188733 Ga0070671_1001887332 239
6 3300005341 Ga0070691_10001884 Ga0070691_100018844 240
7 3300009551 Ga0105238_10116643 Ga0105238_101166432 240
8 3300025924 Ga0207694_10032905 Ga0207694_100329054 240
9 3300005327 Ga0070658_10489049 Ga0070658_104890491 241
10 3300025909 Ga0207705_10386290 Ga0207705_103862902 241
11 3300009551 Ga0105238_10298171 Ga0105238_102981712 243
12 iso_pu_bacteria 3000405567 3000405837 243
13 3300005614 Ga0068856_100131960 Ga0068856_1001319602 244
14 3300025913 Ga0207695_10019086 Ga0207695_100190864 244
15 3300053730 Ga0500645_000115 Ga0500645_000115_52035_52898 244
16 3300005366 Ga0070659_100001580 Ga0070659_1000015807 245
17 3300013105 Ga0157369_10281184 Ga0157369_102811842 245
18 3300025919 Ga0207657_10187148 Ga0207657_101871482 245
19 3300025932 Ga0207690_10001660 Ga0207690_100016602 245
20 3300005435 Ga0070714_100036203 Ga0070714_1000362032 246
21 3300006914 Ga0075436_100002862 Ga0075436_1000028627 246
22 3300025929 Ga0207664_10018226 Ga0207664_100182265 246
23 3300037471 Ga0395905_0275468 Ga0395905_0275468_777_1535 246
24 3300050514 nmdc:mga08x19_42285_c1 nmdc:mga08x19_42285_c1_188_940 246
25 3300047320 Ga0495672_0070687 Ga0495672_0070687_327_1148 247
26 3300048904 Ga0496101_0112069 Ga0496101_0112069_993_1739 247
27 3300048909 Ga0496106_0231049 Ga0496106_0231049_501_1247 247
28 3300048911 Ga0496108_0185585 Ga0496108_0185585_927_1673 247
29 3300048912 Ga0496109_0152570 Ga0496109_0152570_1090_1836 247
30 3300013306 Ga0163162_10219050 Ga0163162_102190501 248
31 3300046471 Ga0495650_0065475 Ga0495650_0065475_354_1145 248
32 3300005336 Ga0070680_100018921 Ga0070680_1000189215 250
33 3300025917 Ga0207660_10125014 Ga0207660_101250142 250
34 iso_pu_bacteria 2738543009 2739226030 250
35 3300005329 Ga0070683_100550768 Ga0070683_1005507681 251
36 3300006846 Ga0075430_100156654 Ga0075430_1001566542 252
37 3300003791 Ga0055530_10004019 Ga0055530_100040192 253
38 3300003794 Ga0055531_10023274 Ga0055531_100232743 253
39 3300004625 Ga0055543_1009424 Ga0055543_10094242 253
40 3300005262 Ga0065165_1001146 Ga0065165_10011462 253
41 3300025297 Ga0209758_1013392 Ga0209758_10133921 253
42 3300025298 Ga0209050_1000053 Ga0209050_1000053148 253
43 3300025304 Ga0209257_1002095 Ga0209257_100209522 253
44 3300025304 Ga0209257_1009170 Ga0209257_10091702 253
45 3300005458 Ga0070681_10022745 Ga0070681_100227454 254
46 3300005563 Ga0068855_100050535 Ga0068855_1000505354 254
47 3300006178 Ga0075367_10132862 Ga0075367_101328622 254
48 3300009093 Ga0105240_10011271 Ga0105240_1001127111 254
49 3300013104 Ga0157370_10261508 Ga0157370_102615082 254
50 3300013307 Ga0157372_10034828 Ga0157372_100348282 254
51 3300021361 Ga0213872_10001301 Ga0213872_1000130113 254
52 3300025912 Ga0207707_10011273 Ga0207707_100112733 254
53 3300025913 Ga0207695_10027690 Ga0207695_100276907 254
54 3300025981 Ga0207640_10069712 Ga0207640_100697122 254
55 3300028794 Ga0307515_10219799 Ga0307515_102197991 254
56 3300037418 Ga0395900_0204202 Ga0395900_0204202_929_1705 254
57 3300037471 Ga0395905_0000565 Ga0395905_0000565_33906_34682 254
58 3300037471 Ga0395905_0056714 Ga0395905_0056714_53_919 254
59 3300039447 Ga0436361_0829477 Ga0436361_0829477_2114_2899 254
60 3300050494 nmdc:mga06z11_107457_c1 nmdc:mga06z11_107457_c1_397_1197 254
61 3300053108 Ga0500562_003631 Ga0500562_003631_257_1033 254
62 3300005336 Ga0070680_100004162 Ga0070680_1000041624 255
63 3300005337 Ga0070682_100002262 Ga0070682_1000022628 255
64 3300005339 Ga0070660_100000329 Ga0070660_10000032910 255
65 3300005341 Ga0070691_10003790 Ga0070691_100037902 255
66 3300005458 Ga0070681_10008549 Ga0070681_100085493 255
67 3300005530 Ga0070679_100010375 Ga0070679_1000103754 255
68 3300005539 Ga0068853_100028442 Ga0068853_1000284422 255
69 3300005563 Ga0068855_100006117 Ga0068855_1000061174 255
70 3300009093 Ga0105240_10006381 Ga0105240_100063818 255
71 3300013104 Ga0157370_10006874 Ga0157370_100068744 255
72 3300013307 Ga0157372_10102076 Ga0157372_101020762 255
73 3300025912 Ga0207707_10018446 Ga0207707_100184463 255
74 3300025913 Ga0207695_10082102 Ga0207695_100821022 255
75 3300025917 Ga0207660_10005032 Ga0207660_100050328 255
76 3300025919 Ga0207657_10001028 Ga0207657_100010289 255
77 3300025921 Ga0207652_10002041 Ga0207652_100020418 255
78 3300026041 Ga0207639_10080348 Ga0207639_100803482 255
79 3300005614 Ga0068856_100053324 Ga0068856_1000533243 256
80 3300009174 Ga0105241_10339675 Ga0105241_103396752 256
81 3300025261 Ga0209233_1040127 Ga0209233_10401271 256
82 3300046512 Ga0495610_0000029 Ga0495610_0000029_14033_14824 256
83 3300046512 Ga0495610_0000810 Ga0495610_0000810_9646_10428 256
84 3300046660 Ga0495625_0001967 Ga0495625_0001967_9814_10605 256
85 3300049571 Ga0501034_0167962 Ga0501034_0167962_309_1112 256
86 3300049581 Ga0501047_0290677 Ga0501047_0290677_502_1305 256
87 3300049582 Ga0501048_0154952 Ga0501048_0154952_384_1187 256
88 3300049585 Ga0501069_0011964 Ga0501069_0011964_1221_2024 256
89 3300049588 Ga0501072_0314668 Ga0501072_0314668_366_1169 256
90 3300049590 Ga0501074_0121658 Ga0501074_0121658_1028_1831 256
91 3300053086 Ga0500578_0000008 Ga0500578_0000008_111981_112763 256
92 3300053103 Ga0500555_007211 Ga0500555_007211_586_1368 256
93 3300053118 Ga0500594_0000110 Ga0500594_0000110_7993_8802 256
94 3300054114 Ga0501084_0029845 Ga0501084_0029845_650_1453 256
95 3300005327 Ga0070658_10127930 Ga0070658_101279302 257
96 3300037312 Ga0395899_0068363 Ga0395899_0068363_1384_2175 257
97 3300037418 Ga0395900_0007990 Ga0395900_0007990_9030_9821 257
98 3300037466 Ga0395898_0307007 Ga0395898_0307007_578_1369 257
99 3300037471 Ga0395905_0060679 Ga0395905_0060679_820_1611 257
100 3300049581 Ga0501047_0035095 Ga0501047_0035095_1920_2693 257
101 3300049823 Ga0501044_0033273 Ga0501044_0033273_1404_2177 257
102 3300003791 Ga0055530_10000044 Ga0055530_1000004421 258
103 3300003794 Ga0055531_10000072 Ga0055531_1000007220 258
104 3300005548 Ga0070665_100063960 Ga0070665_1000639602 258
105 3300009545 Ga0105237_10000169 Ga0105237_1000016977 258
106 3300013307 Ga0157372_10113382 Ga0157372_101133822 258
107 3300025914 Ga0207671_10086999 Ga0207671_100869992 258
108 3300025940 Ga0207691_10238510 Ga0207691_102385102 258
109 3300025960 Ga0207651_10534491 Ga0207651_105344911 258
110 3300028379 Ga0268266_10212323 Ga0268266_102123232 258
111 3300028786 Ga0307517_10012770 Ga0307517_100127708 258
112 3300031456 Ga0307513_10000414 Ga0307513_1000041434 258
113 3300031456 Ga0307513_10310549 Ga0307513_103105492 258
114 3300046516 Ga0495628_0483871 Ga0495628_0483871_46_837 258
115 3300046648 Ga0495611_0000761 Ga0495611_0000761_1490_2296 258
116 3300046648 Ga0495611_0059738 Ga0495611_0059738_368_1165 258
117 3300046684 Ga0495669_0045999 Ga0495669_0045999_61_852 258
118 3300048915 Ga0496112_0073628 Ga0496112_0073628_1985_2776 258
119 3300049581 Ga0501047_0001868 Ga0501047_0001868_8385_9161 258
120 3300005459 Ga0068867_100189577 Ga0068867_1001895772 259
121 3300005435 Ga0070714_100214460 Ga0070714_1002144602 260
122 3300006852 Ga0075433_10037431 Ga0075433_100374312 260
123 3300006880 Ga0075429_100282787 Ga0075429_1002827871 260
124 3300009147 Ga0114129_10130892 Ga0114129_101308922 260
125 3300025929 Ga0207664_10189237 Ga0207664_101892372 260
126 3300050508 nmdc:mga09592_364352_c1 nmdc:mga09592_364352_c1_407_1213 260
127 3300050511 nmdc:mga08y16_899956_c1 nmdc:mga08y16_899956_c1_65_859 260
128 3300050515 nmdc:mga0a205_87529_c2 nmdc:mga0a205_87529_c2_94_900 260
129 3300001915 JGI24741J21665_1013005 JGI24741J21665_10130052 261
130 3300005329 Ga0070683_100071195 Ga0070683_1000711952 261
131 3300005339 Ga0070660_100069984 Ga0070660_1000699842 261
132 3300005344 Ga0070661_100030362 Ga0070661_1000303624 261
133 3300005366 Ga0070659_100014105 Ga0070659_1000141051 261
134 3300005530 Ga0070679_100024759 Ga0070679_1000247595 261
135 3300005539 Ga0068853_100071106 Ga0068853_1000711063 261
136 3300005577 Ga0068857_100076947 Ga0068857_1000769473 261
137 3300009093 Ga0105240_10050599 Ga0105240_100505994 261
138 3300009545 Ga0105237_10049947 Ga0105237_100499473 261
139 3300009551 Ga0105238_10081547 Ga0105238_100815474 261
140 3300013104 Ga0157370_10167169 Ga0157370_101671693 261
141 3300013105 Ga0157369_10028083 Ga0157369_100280836 261
142 3300013307 Ga0157372_10191067 Ga0157372_101910671 261
143 3300013308 Ga0157375_10182586 Ga0157375_101825862 261
144 3300014325 Ga0163163_10057186 Ga0163163_100571863 261
145 3300025298 Ga0209050_1000014 Ga0209050_1000014669 261
146 3300025304 Ga0209257_1000019 Ga0209257_100001923 261
147 3300025904 Ga0207647_10119554 Ga0207647_101195542 261
148 3300025912 Ga0207707_10003273 Ga0207707_100032738 261
149 3300025914 Ga0207671_10149327 Ga0207671_101493273 261
150 3300025919 Ga0207657_10107937 Ga0207657_101079372 261
151 3300025920 Ga0207649_10090980 Ga0207649_100909802 261
152 3300025937 Ga0207669_10089862 Ga0207669_100898621 261
153 3300025949 Ga0207667_10006749 Ga0207667_100067494 261
154 3300026116 Ga0207674_10010954 Ga0207674_100109543 261
155 3300031241 Ga0265325_10085828 Ga0265325_100858281 261
156 3300031595 Ga0265313_10093092 Ga0265313_100930922 261
157 3300037853 Ga0436364_0349745 Ga0436364_0349745_101_886 261
158 3300039450 Ga0436363_0275130 Ga0436363_0275130_116_901 261
159 3300046616 Ga0495668_0190957 Ga0495668_0190957_313_1107 261
160 3300048915 Ga0496112_0219320 Ga0496112_0219320_769_1563 261
161 3300049758 Ga0501241_002160 Ga0501241_002160_1274_2062 261
162 3300049758 Ga0501241_005227 Ga0501241_005227_1214_2002 261
163 3300050507 nmdc:mga05p37_5569_c1 nmdc:mga05p37_5569_c1_12317_13138 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

81

282

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qhz-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bdi_3914) from parabacteroides distasonis atcc 8503 at 2.13 a resolution 0.9433 27 260
4qhz-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bdi_3914) from parabacteroides distasonis atcc 8503 at 2.13 a resolution 0.9198 27 260
3imm-assembly3.cif.gz_C crystal structure of putative glycosyl hydrolase (yp_001301887.1) from parabacteroides distasonis atcc 8503 at 2.00 a resolution 0.7332 57 260
3s5q-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_2473) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.731 56 260
3h3l-assembly2.cif.gz_B crystal structure of putative sugar hydrolase (yp_001304206.1) from parabacteroides distasonis atcc 8503 at 1.59 a resolution 0.7307 57 260
ID Description Score Start End Superfamily
4qhzB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.9453 27 260 2.60.120.560
4qhzB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.9246 27 260 2.60.120.560
3immB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7235 57 260 2.60.120.560
3immB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7133 57 260 2.60.120.560
4jqtB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.701 56 261 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A1M3HMK7-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9918 30 260 GO:0016787
AF-A0A258KRV0-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9918 32 261 GO:0016787
AF-A0A519VZH9-F1-model_v4 DUF1080 domain-containing protein 0.9917 58 260 GO:0016787
AF-A0A512BIV1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9863 145 260 GO:0016787
AF-A0A327X1G4-F1-model_v4 Uncharacterized protein DUF1080 0.9822 16 260 GO:0016787

Feature Viewer

pLDDT pTM Quality
88.5 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map