F241884

General Info

Members Datasets Scaffolds Average Seq Length
163 131 159 88

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10272457|Ga0265323_102724572
Length 87
Sequence MSASIYEVRITRRAEKDIETLTPKLKKKLCEILTEVIARNPFEGKKLVGNLSGSYSYRLNYQDRIVYSVDRENRIVYIERARTHYGD

Samples

Sample ID Description Type Environment
1 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
2 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
3 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
83 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
102 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
103 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
110 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
111 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
112 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
120 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
124 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
130 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
131 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.93
Metatranscriptomes 0.61
Isolates 2.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.61
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10049653 3300005335 Bacteria 2820
2 Ga0070680_100060878 3300005336 Bacteria 3089
3 Ga0068868_100360578 3300005338 Bacteria 1247
4 Ga0070660_100129503 3300005339 Bacteria 2018
5 Ga0070660_100574215 3300005339 Unclassified 942
6 Ga0070671_100354587 3300005355 Bacteria 1252
7 Ga0070659_101872768 3300005366 Unclassified 538
8 Ga0070667_100264617 3300005367 Bacteria 1540
9 Ga0070667_100856006 3300005367 Bacteria 845
10 Ga0070714_100230004 3300005435 Bacteria 1708
11 Ga0070663_100061902 3300005455 Bacteria 2696
12 Ga0070706_100436027 3300005467 Unclassified 1219
13 Ga0070679_100097994 3300005530 Bacteria 2919
14 Ga0070679_100208727 3300005530 Unclassified 1917
15 Ga0070679_100405265 3300005530 Bacteria 1309
16 Ga0070686_100325558 3300005544 Bacteria 1147
17 Ga0068855_100019912 3300005563 Bacteria 8058
18 Ga0068856_100413682 3300005614 Bacteria 1368
19 Ga0068852_101408624 3300005616 Bacteria 719
20 Ga0068859_102063098 3300005617 Bacteria 629
21 Ga0068864_100171660 3300005618 Bacteria 1977
22 Ga0068864_101828287 3300005618 Bacteria 613
23 Ga0068858_100337763 3300005842 Unclassified 1441
24 Ga0068860_100072591 3300005843 Bacteria 3271
25 Ga0068860_100343985 3300005843 Bacteria 1467
26 Ga0070717_10152934 3300006028 Bacteria 1997
27 Ga0070717_12138550 3300006028 Bacteria 503
28 Ga0097621_101537597 3300006237 Bacteria 632
29 Ga0068871_100679714 3300006358 Bacteria 942
30 Ga0075433_10672227 3300006852 Unclassified 908
31 Ga0075434_100523069 3300006871 Bacteria 1207
32 Ga0068865_100792257 3300006881 Bacteria 817
33 Ga0075436_100652714 3300006914 Unclassified 777
34 Ga0097620_100060104 3300006931 Bacteria 3829
35 Ga0097620_100916484 3300006931 Unclassified 961
36 Ga0097620_102063069 3300006931 Bacteria 629
37 Ga0105240_10060950 3300009093 Unclassified 4703
38 Ga0105240_10094978 3300009093 Bacteria 3636
39 Ga0105245_10168785 3300009098 Bacteria 2082
40 Ga0105242_10471938 3300009176 Bacteria 1187
41 Ga0105248_10148535 3300009177 Bacteria 2644
42 Ga0105248_12171919 3300009177 Bacteria 632
43 Ga0105248_12217408 3300009177 Bacteria 625
44 Ga0105237_10319328 3300009545 Bacteria 1556
45 Ga0105238_10000001 3300009551 Bacteria 2036163
46 Ga0105238_10347601 3300009551 Bacteria 1472
47 Ga0105246_10165659 3300011119 Bacteria 1688
48 Ga0157373_10324742 3300013100 Bacteria 1095
49 Ga0157370_11003843 3300013104 Bacteria 755
50 Ga0157369_10470360 3300013105 Bacteria 1301
51 Ga0157369_10688191 3300013105 Unclassified 1053
52 Ga0157369_10865116 3300013105 Bacteria 928
53 Ga0157374_10000022 3300013296 Bacteria 270307
54 Ga0163162_10931804 3300013306 Bacteria 980
55 Ga0157377_10000009 3300014745 Bacteria 385287
56 Ga0157379_11845912 3300014968 Unclassified 595
57 Ga0157376_10551860 3300014969 Bacteria 1140
58 Ga0213876_10002449 3300021384 Bacteria 10900
59 Ga0207680_10100966 3300025903 Bacteria 1854
60 Ga0207647_10005769 3300025904 Bacteria 9034
61 Ga0207705_10880015 3300025909 Unclassified 694
62 Ga0207707_10325343 3300025912 Bacteria 1327
63 Ga0207695_10154182 3300025913 Bacteria 2233
64 Ga0207695_10551980 3300025913 Bacteria 1034
65 Ga0207660_10241000 3300025917 Unclassified 1424
66 Ga0207657_10018590 3300025919 Bacteria 6625
67 Ga0207657_10507324 3300025919 Unclassified 945
68 Ga0207652_10182585 3300025921 Unclassified 1886
69 Ga0207652_10649854 3300025921 Unclassified 943
70 Ga0207646_11246960 3300025922 Unclassified 651
71 Ga0207681_10000025 3300025923 Bacteria 203205
72 Ga0207694_10217197 3300025924 Bacteria 1559
73 Ga0207687_10198231 3300025927 Bacteria 1567
74 Ga0207664_11072164 3300025929 Unclassified 721
75 Ga0207644_10739964 3300025931 Unclassified 821
76 Ga0207690_11227738 3300025932 Unclassified 626
77 Ga0207686_10435826 3300025934 Bacteria 1005
78 Ga0207711_10297893 3300025941 Bacteria 1487
79 Ga0207711_11912946 3300025941 Bacteria 536
80 Ga0207689_10037783 3300025942 Bacteria 4002
81 Ga0207667_11351645 3300025949 Unclassified 687
82 Ga0207668_10530433 3300025972 Bacteria 1017
83 Ga0207658_10359535 3300025986 Bacteria 1270
84 Ga0207658_10782897 3300025986 Bacteria 865
85 Ga0207677_10643200 3300026023 Bacteria 935
86 Ga0207703_10268603 3300026035 Unclassified 1544
87 Ga0207639_10828944 3300026041 Bacteria 863
88 Ga0207641_10043324 3300026088 Bacteria 3779
89 Ga0207641_12375945 3300026088 Unclassified 529
90 Ga0207676_10170646 3300026095 Unclassified 1895
91 Ga0207676_11030428 3300026095 Bacteria 812
92 Ga0268264_10125012 3300028381 Bacteria 2272
93 Ga0268264_10386764 3300028381 Bacteria 1341
94 Ga0265334_10148427 3300028573 Bacteria 828
95 Ga0265318_10011190 3300028577 Bacteria 3875
96 Ga0265323_10272457 3300028653 Bacteria 525
97 Ga0265322_10106795 3300028654 Bacteria 797
98 Ga0265338_10166101 3300028800 Bacteria 1699
99 Ga0265338_10221922 3300028800 Bacteria 1411
100 Ga0265324_10028866 3300029957 Bacteria 1954
101 Ga0265332_10035056 3300031238 Bacteria 2180
102 Ga0265320_10000721 3300031240 Bacteria 25291
103 Ga0265320_10033893 3300031240 Bacteria 2603
104 Ga0265329_10058118 3300031242 Bacteria 1225
105 Ga0265340_10387114 3300031247 Viruses 617
106 Ga0265339_10119016 3300031249 Bacteria 1359
107 Ga0265327_10269931 3300031251 Unclassified 754
108 Ga0265316_10328570 3300031344 Bacteria 1110
109 Ga0265316_10423782 3300031344 Unclassified 956
110 Ga0307408_100000004 3300031548 Bacteria 572889
111 Ga0265313_10090730 3300031595 Bacteria 1372
112 Ga0265313_10105119 3300031595 Bacteria 1248
113 Ga0265314_10005398 3300031711 Bacteria 11548
114 Ga0265314_10156242 3300031711 Bacteria 1393
115 Ga0265342_10185733 3300031712 Bacteria 1136
116 Ga0316578_10450404 3300031728 Bacteria 761
117 Ga0307410_11836456 3300031852 Bacteria 539
118 Ga0316593_10354188 3300032168 Bacteria 562
119 Ga0316574_0004289 3300035398 Bacteria 7448
120 Ga0373927_0464589 3300035695 Bacteria 836
121 Ga0373937_0422099 3300036401 Bacteria 1266
122 Ga0316584_0084044 3300036712 Bacteria 2384
123 Ga0316584_0384974 3300036712 Unclassified 1002
124 Ga0395899_0010451 3300037312 Bacteria 7109
125 Ga0395898_0242117 3300037466 Bacteria 1720
126 Ga0395901_0200540 3300038443 Bacteria 2091
127 Ga0400486_03418 3300038742 Bacteria 18452
128 Ga0400486_14649 3300038742 Bacteria 1258
129 Ga0400483_150215 3300039062 Bacteria 2905
130 Ga0400489_18826 3300039093 Bacteria 1240
131 Ga0400489_69719 3300039093 Bacteria 3464
132 Ga0436365_0181741 3300039437 Bacteria 58736
133 Ga0439446_0000516 3300042156 Bacteria 7747
134 Ga0451577_0143932 3300042876 Unclassified 2143
135 Ga0453683_0022407 3300044673 Bacteria 4029
136 Ga0453684_0533484 3300044712 Bacteria 1295
137 Ga0495582_0004692 3300046473 Bacteria 7687
138 Ga0495639_0034962 3300046475 Bacteria 2248
139 Ga0495610_0016190 3300046512 Bacteria 4304
140 Ga0495630_1030658 3300046517 Unclassified 625
141 Ga0495666_0122220 3300046526 Bacteria 1219
142 Ga0495586_0014063 3300046535 Unclassified 4251
143 Ga0495634_0675023 3300046642 Unclassified 595
144 Ga0495635_0580135 3300046663 Unclassified 733
145 Ga0495658_0016511 3300046683 Bacteria 3800
146 Ga0495581_0422170 3300047315 Unclassified 777
147 Ga0496106_1561999 3300048909 Unclassified 506
148 Ga0496121_0033039 3300048924 Bacteria 4691
149 Ga0496124_0845935 3300048927 Bacteria 561
150 Ga0496126_0038395 3300048929 Bacteria 4456
151 Ga0496126_0238703 3300048929 Bacteria 1520
152 Ga0501077_0174685 3300049593 Bacteria 1365
153 Ga0501235_061727 3300049669 Bacteria 878
154 nmdc:mga0n895_283949_c1 3300050512 Bacteria 1678
155 nmdc:mga0a205_1493965_c1 3300050515 Unclassified 524
156 Ga0590071_011052 3300059421 Bacteria 2112
157 Ga0590074_016284 3300059423 Bacteria 1265
158 Ga0590075_001818 3300059424 Bacteria 5209
159 Ga0590077_004602 3300059426 Bacteria 2827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028653 Ga0265323_10272457 Ga0265323_102724572 83
2 iso_pu_bacteria 2919501602 2919503308 83
3 iso_pu_bacteria 2926063275 2926066121 83
4 iso_pu_bacteria 3007315729 3007318240 83
5 3300050515 nmdc:mga0a205_1493965_c1 nmdc:mga0a205_1493965_c1_141_395 84
6 iso_pu_bacteria 646564506 646813632 84
7 3300031852 Ga0307410_11836456 Ga0307410_118364562 85
8 3300025924 Ga0207694_10217197 Ga0207694_102171972 86
9 3300005335 Ga0070666_10049653 Ga0070666_100496533 87
10 3300005336 Ga0070680_100060878 Ga0070680_1000608788 87
11 3300005338 Ga0068868_100360578 Ga0068868_1003605782 87
12 3300005339 Ga0070660_100129503 Ga0070660_1001295033 87
13 3300005339 Ga0070660_100574215 Ga0070660_1005742152 87
14 3300005355 Ga0070671_100354587 Ga0070671_1003545872 87
15 3300005366 Ga0070659_101872768 Ga0070659_1018727681 87
16 3300005367 Ga0070667_100264617 Ga0070667_1002646172 87
17 3300005367 Ga0070667_100856006 Ga0070667_1008560063 87
18 3300005435 Ga0070714_100230004 Ga0070714_1002300044 87
19 3300005455 Ga0070663_100061902 Ga0070663_1000619023 87
20 3300005467 Ga0070706_100436027 Ga0070706_1004360272 87
21 3300005530 Ga0070679_100097994 Ga0070679_1000979942 87
22 3300005530 Ga0070679_100208727 Ga0070679_1002087274 87
23 3300005530 Ga0070679_100405265 Ga0070679_1004052652 87
24 3300005544 Ga0070686_100325558 Ga0070686_1003255582 87
25 3300005563 Ga0068855_100019912 Ga0068855_1000199124 87
26 3300005614 Ga0068856_100413682 Ga0068856_1004136822 87
27 3300005616 Ga0068852_101408624 Ga0068852_1014086242 87
28 3300005617 Ga0068859_102063098 Ga0068859_1020630981 87
29 3300005618 Ga0068864_100171660 Ga0068864_1001716603 87
30 3300005618 Ga0068864_101828287 Ga0068864_1018282872 87
31 3300005842 Ga0068858_100337763 Ga0068858_1003377633 87
32 3300005843 Ga0068860_100072591 Ga0068860_1000725912 87
33 3300005843 Ga0068860_100343985 Ga0068860_1003439852 87
34 3300006028 Ga0070717_10152934 Ga0070717_101529343 87
35 3300006028 Ga0070717_12138550 Ga0070717_121385502 87
36 3300006237 Ga0097621_101537597 Ga0097621_1015375972 87
37 3300006358 Ga0068871_100679714 Ga0068871_1006797143 87
38 3300006852 Ga0075433_10672227 Ga0075433_106722271 87
39 3300006871 Ga0075434_100523069 Ga0075434_1005230693 87
40 3300006881 Ga0068865_100792257 Ga0068865_1007922572 87
41 3300006914 Ga0075436_100652714 Ga0075436_1006527142 87
42 3300006931 Ga0097620_100060104 Ga0097620_1000601044 87
43 3300006931 Ga0097620_100916484 Ga0097620_1009164843 87
44 3300006931 Ga0097620_102063069 Ga0097620_1020630691 87
45 3300009093 Ga0105240_10060950 Ga0105240_100609503 87
46 3300009093 Ga0105240_10094978 Ga0105240_100949784 87
47 3300009098 Ga0105245_10168785 Ga0105245_101687853 87
48 3300009176 Ga0105242_10471938 Ga0105242_104719382 87
49 3300009177 Ga0105248_10148535 Ga0105248_101485353 87
50 3300009177 Ga0105248_12171919 Ga0105248_121719192 87
51 3300009177 Ga0105248_12217408 Ga0105248_122174081 87
52 3300009545 Ga0105237_10319328 Ga0105237_103193282 87
53 3300009551 Ga0105238_10000001 Ga0105238_10000001969 87
54 3300009551 Ga0105238_10347601 Ga0105238_103476013 87
55 3300011119 Ga0105246_10165659 Ga0105246_101656593 87
56 3300013100 Ga0157373_10324742 Ga0157373_103247422 87
57 3300013104 Ga0157370_11003843 Ga0157370_110038431 87
58 3300013105 Ga0157369_10470360 Ga0157369_104703602 87
59 3300013105 Ga0157369_10688191 Ga0157369_106881912 87
60 3300013105 Ga0157369_10865116 Ga0157369_108651162 87
61 3300013296 Ga0157374_10000022 Ga0157374_10000022106 87
62 3300013306 Ga0163162_10931804 Ga0163162_109318043 87
63 3300014745 Ga0157377_10000009 Ga0157377_1000000994 87
64 3300014968 Ga0157379_11845912 Ga0157379_118459122 87
65 3300014969 Ga0157376_10551860 Ga0157376_105518602 87
66 3300021384 Ga0213876_10002449 Ga0213876_100024494 87
67 3300025903 Ga0207680_10100966 Ga0207680_101009662 87
68 3300025904 Ga0207647_10005769 Ga0207647_100057692 87
69 3300025909 Ga0207705_10880015 Ga0207705_108800152 87
70 3300025912 Ga0207707_10325343 Ga0207707_103253432 87
71 3300025913 Ga0207695_10154182 Ga0207695_101541822 87
72 3300025913 Ga0207695_10551980 Ga0207695_105519803 87
73 3300025917 Ga0207660_10241000 Ga0207660_102410002 87
74 3300025919 Ga0207657_10018590 Ga0207657_100185904 87
75 3300025919 Ga0207657_10507324 Ga0207657_105073242 87
76 3300025921 Ga0207652_10182585 Ga0207652_101825852 87
77 3300025921 Ga0207652_10649854 Ga0207652_106498542 87
78 3300025922 Ga0207646_11246960 Ga0207646_112469602 87
79 3300025923 Ga0207681_10000025 Ga0207681_10000025132 87
80 3300025927 Ga0207687_10198231 Ga0207687_101982313 87
81 3300025929 Ga0207664_11072164 Ga0207664_110721642 87
82 3300025931 Ga0207644_10739964 Ga0207644_107399641 87
83 3300025932 Ga0207690_11227738 Ga0207690_112277382 87
84 3300025934 Ga0207686_10435826 Ga0207686_104358262 87
85 3300025941 Ga0207711_10297893 Ga0207711_102978932 87
86 3300025941 Ga0207711_11912946 Ga0207711_119129462 87
87 3300025942 Ga0207689_10037783 Ga0207689_100377832 87
88 3300025949 Ga0207667_11351645 Ga0207667_113516451 87
89 3300025972 Ga0207668_10530433 Ga0207668_105304333 87
90 3300025986 Ga0207658_10359535 Ga0207658_103595352 87
91 3300025986 Ga0207658_10782897 Ga0207658_107828973 87
92 3300026023 Ga0207677_10643200 Ga0207677_106432003 87
93 3300026035 Ga0207703_10268603 Ga0207703_102686034 87
94 3300026041 Ga0207639_10828944 Ga0207639_108289441 87
95 3300026088 Ga0207641_10043324 Ga0207641_100433246 87
96 3300026088 Ga0207641_12375945 Ga0207641_123759452 87
97 3300026095 Ga0207676_10170646 Ga0207676_101706464 87
98 3300026095 Ga0207676_11030428 Ga0207676_110304282 87
99 3300028381 Ga0268264_10125012 Ga0268264_101250122 87
100 3300028381 Ga0268264_10386764 Ga0268264_103867642 87
101 3300028573 Ga0265334_10148427 Ga0265334_101484272 87
102 3300028577 Ga0265318_10011190 Ga0265318_100111904 87
103 3300028654 Ga0265322_10106795 Ga0265322_101067953 87
104 3300028800 Ga0265338_10166101 Ga0265338_101661013 87
105 3300028800 Ga0265338_10221922 Ga0265338_102219222 87
106 3300029957 Ga0265324_10028866 Ga0265324_100288661 87
107 3300031238 Ga0265332_10035056 Ga0265332_100350564 87
108 3300031240 Ga0265320_10000721 Ga0265320_100007212 87
109 3300031240 Ga0265320_10033893 Ga0265320_100338934 87
110 3300031242 Ga0265329_10058118 Ga0265329_100581183 87
111 3300031247 Ga0265340_10387114 Ga0265340_103871141 87
112 3300031249 Ga0265339_10119016 Ga0265339_101190162 87
113 3300031251 Ga0265327_10269931 Ga0265327_102699311 87
114 3300031344 Ga0265316_10328570 Ga0265316_103285701 87
115 3300031344 Ga0265316_10423782 Ga0265316_104237822 87
116 3300031548 Ga0307408_100000004 Ga0307408_100000004198 87
117 3300031595 Ga0265313_10090730 Ga0265313_100907303 87
118 3300031595 Ga0265313_10105119 Ga0265313_101051191 87
119 3300031711 Ga0265314_10005398 Ga0265314_1000539811 87
120 3300031711 Ga0265314_10156242 Ga0265314_101562422 87
121 3300031712 Ga0265342_10185733 Ga0265342_101857332 87
122 3300031728 Ga0316578_10450404 Ga0316578_104504042 87
123 3300032168 Ga0316593_10354188 Ga0316593_103541881 87
124 3300035398 Ga0316574_0004289 Ga0316574_0004289_6070_6336 87
125 3300035695 Ga0373927_0464589 Ga0373927_0464589_222_515 87
126 3300036401 Ga0373937_0422099 Ga0373937_0422099_848_1111 87
127 3300036712 Ga0316584_0084044 Ga0316584_0084044_825_1088 87
128 3300036712 Ga0316584_0384974 Ga0316584_0384974_705_968 87
129 3300037312 Ga0395899_0010451 Ga0395899_0010451_5263_5529 87
130 3300037466 Ga0395898_0242117 Ga0395898_0242117_282_548 87
131 3300038443 Ga0395901_0200540 Ga0395901_0200540_992_1258 87
132 3300038742 Ga0400486_03418 Ga0400486_03418_16844_17107 87
133 3300038742 Ga0400486_14649 Ga0400486_14649_370_639 87
134 3300039062 Ga0400483_150215 Ga0400483_150215_578_841 87
135 3300039093 Ga0400489_18826 Ga0400489_18826_835_1107 87
136 3300039093 Ga0400489_69719 Ga0400489_69719_766_1029 87
137 3300039437 Ga0436365_0181741 Ga0436365_0181741_49857_50120 87
138 3300042156 Ga0439446_0000516 Ga0439446_0000516_1646_1909 87
139 3300042876 Ga0451577_0143932 Ga0451577_0143932_465_728 87
140 3300044673 Ga0453683_0022407 Ga0453683_0022407_358_624 87
141 3300044712 Ga0453684_0533484 Ga0453684_0533484_135_398 87
142 3300046473 Ga0495582_0004692 Ga0495582_0004692_3120_3386 87
143 3300046475 Ga0495639_0034962 Ga0495639_0034962_1687_1953 87
144 3300046512 Ga0495610_0016190 Ga0495610_0016190_2273_2536 87
145 3300046517 Ga0495630_1030658 Ga0495630_1030658_249_515 87
146 3300046526 Ga0495666_0122220 Ga0495666_0122220_124_390 87
147 3300046535 Ga0495586_0014063 Ga0495586_0014063_3789_4055 87
148 3300046642 Ga0495634_0675023 Ga0495634_0675023_67_333 87
149 3300046663 Ga0495635_0580135 Ga0495635_0580135_358_624 87
150 3300046683 Ga0495658_0016511 Ga0495658_0016511_788_1054 87
151 3300047315 Ga0495581_0422170 Ga0495581_0422170_422_688 87
152 3300048909 Ga0496106_1561999 Ga0496106_1561999_12_290 87
153 3300048924 Ga0496121_0033039 Ga0496121_0033039_765_1028 87
154 3300048927 Ga0496124_0845935 Ga0496124_0845935_44_307 87
155 3300048929 Ga0496126_0038395 Ga0496126_0038395_2954_3217 87
156 3300048929 Ga0496126_0238703 Ga0496126_0238703_416_679 87
157 3300049593 Ga0501077_0174685 Ga0501077_0174685_591_854 87
158 3300049669 Ga0501235_061727 Ga0501235_061727_468_731 87
159 3300050512 nmdc:mga0n895_283949_c1 nmdc:mga0n895_283949_c1_1299_1565 87
160 3300059421 Ga0590071_011052 Ga0590071_011052_411_674 87
161 3300059423 Ga0590074_016284 Ga0590074_016284_478_741 87
162 3300059424 Ga0590075_001818 Ga0590075_001818_3121_3384 87
163 3300059426 Ga0590077_004602 Ga0590077_004602_391_654 87

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15781

ParE-like_toxin

ParE-like toxin of type II bacterial toxin-antitoxin system

8

86

0.88

PF06769

YoeB_toxin

YoeB-like toxin of bacterial type II toxin-antitoxin system

9

85

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v5z-assembly1.cif.gz_D crystal structure of heterotetrameric complex of sa2yoeb-sa2yefm toxin-antitoxin from staphylococcus aureus 0.9046 1 87
6n90-assembly1.cif.gz_B yoeb/pare toxin from agrobacterium tumefaciens 0.9022 4 86
3oei-assembly4.cif.gz_O crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358-relbe3) 0.8906 4 86
6n90-assembly1.cif.gz_A yoeb/pare toxin from agrobacterium tumefaciens 0.8833 4 86
3oei-assembly4.cif.gz_O crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358-relbe3) 0.8807 4 86
ID Description Score Start End Superfamily
af_Q2FVF8_1_87_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9289 1 86 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8861 3 86 3.30.2310.20
4bydY00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8704 4 86 3.30.2310.20
af_P9WF09_1_85_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8669 3 86 3.30.2310.20
4ml0D00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8552 3 85 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A661LX02-F1-model_v4 deleted 1.001 3 82
AF-A0A7X7DUD2-F1-model_v4 Putative mRNA interferase YoeB 1 2 87 GO:0004519
GO:0006401
GO:0045892
AF-A0A1F2VF03-F1-model_v4 Putative mRNA interferase YoeB 0.9993 1 79 GO:0004519
GO:0006401
GO:0045892
AF-A0A3C0V8J2-F1-model_v4 Putative mRNA interferase YoeB 0.9987 1 87 GO:0004519
GO:0006401
GO:0045892
AF-A0A6L5EKN3-F1-model_v4 Putative mRNA interferase YoeB 0.9985 2 87 GO:0004519
GO:0006401
GO:0045892

Feature Viewer

pLDDT pTM Quality
88.94 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map