F241176

General Info

Members Datasets Scaffolds Average Seq Length
163 143 326 98

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100062522|Ga0070665_1000625224
Length 104
Sequence MKVIWTREAPADLADIATYYATNASPVIAEAVGRRFLDVIERVRSAPFSAPRVAHRSQVRVVTVVRYPFRIFYRASGEVIHILHIRHTSRRPLAGLNEPGRQYA

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
15 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
50 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
51 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
52 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
57 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
58 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
66 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
67 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
70 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
81 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
100 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
101 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
123 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
124 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
125 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
126 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
127 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
128 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
129 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
134 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
137 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
138 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
139 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
140 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
141 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
142 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
143 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.71
Metatranscriptomes 0
Isolates 4.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 4.29
Rhizoplane 3.68
Rhizosphere 71.17
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100062522 3300005548 Bacteria 3733
2 JGI25406J46586_10006858 3300003203 Bacteria 5228
3 Ga0055526_1068533 3300003771 Bacteria 728
4 Ga0065165_1106798 3300005262 Bacteria 694
5 Ga0065704_10499132 3300005289 Unclassified 668
6 Ga0070680_100991766 3300005336 Unclassified 725
7 Ga0070674_100845215 3300005356 Bacteria 793
8 Ga0070667_101497507 3300005367 Bacteria 634
9 Ga0070714_100088775 3300005435 Bacteria 2705
10 Ga0070663_100924962 3300005455 Bacteria 755
11 Ga0070665_100358730 3300005548 Bacteria 1463
12 Ga0068859_100338964 3300005617 Bacteria 1598
13 Ga0068860_100000411 3300005843 Bacteria 55810
14 Ga0081538_10014582 3300005981 Bacteria 6145
15 Ga0081540_1133879 3300005983 Bacteria 1007
16 Ga0081539_10011052 3300005985 Bacteria 7216
17 Ga0070717_10235465 3300006028 Bacteria 1613
18 Ga0070717_11670588 3300006028 Unclassified 577
19 Ga0075365_10230699 3300006038 Bacteria 1299
20 Ga0075365_10249631 3300006038 Bacteria 1247
21 Ga0075367_10185424 3300006178 Bacteria 1298
22 Ga0075367_10865251 3300006178 Bacteria 576
23 Ga0075428_100000580 3300006844 Bacteria 37416
24 Ga0075430_100028026 3300006846 Bacteria 4785
25 Ga0075431_100000518 3300006847 Bacteria 32306
26 Ga0075429_100005751 3300006880 Bacteria 10704
27 Ga0075436_100748098 3300006914 Plasmid 726
28 Ga0097620_100338966 3300006931 Bacteria 1598
29 Ga0099795_10128601 3300007788 Bacteria 1020
30 Ga0099795_10158868 3300007788 Bacteria 931
31 Ga0111539_10000651 3300009094 Bacteria 44838
32 Ga0114129_10019741 3300009147 Bacteria 9592
33 Ga0105243_10443116 3300009148 Bacteria 1216
34 Ga0105238_11668517 3300009551 Bacteria 668
35 Ga0099796_10025681 3300010159 Bacteria 1863
36 Ga0105239_11735184 3300010375 Bacteria 723
37 Ga0157378_11690290 3300013297 Unclassified 680
38 Ga0163162_12063489 3300013306 Bacteria 654
39 Ga0157375_11964631 3300013308 Bacteria 695
40 Ga0157380_12026872 3300014326 Bacteria 638
41 Ga0157380_12824715 3300014326 Bacteria 552
42 Ga0157379_11396842 3300014968 Bacteria 678
43 Ga0209256_1058120 3300025299 Bacteria 910
44 Ga0207694_11467058 3300025924 Unclassified 576
45 Ga0207664_10488800 3300025929 Bacteria 1101
46 Ga0207686_10600038 3300025934 Bacteria 866
47 Ga0207669_10253398 3300025937 Bacteria 1312
48 Ga0207704_11538524 3300025938 Unclassified 571
49 Ga0207640_10180717 3300025981 Bacteria 1581
50 Ga0207658_11149110 3300025986 Bacteria 710
51 Ga0207698_10614700 3300026142 Bacteria 1073
52 Ga0209179_1116312 3300027512 Unclassified 597
53 Ga0207428_10002244 3300027907 Bacteria 19409
54 Ga0268264_10000194 3300028381 Bacteria 125395
55 Ga0307517_10365322 3300028786 Bacteria 777
56 Ga0307517_10575657 3300028786 Unclassified 558
57 Ga0265316_10119992 3300031344 Bacteria 1986
58 Ga0307516_10014504 3300031730 Bacteria 8332
59 Ga0307516_10380912 3300031730 Bacteria 1072
60 Ga0307406_10604024 3300031901 Bacteria 905
61 Ga0307409_102146502 3300031995 Bacteria 588
62 Ga0307510_10160109 3300033180 Bacteria 1849
63 Ga0373934_0050094 3300035086 Bacteria 1654
64 Ga0373939_0001981 3300035114 Bacteria 4888
65 Ga0373957_0190290 3300035120 Bacteria 853
66 Ga0373943_0417166 3300035170 Bacteria 776
67 Ga0373955_0057716 3300035172 Bacteria 2133
68 Ga0373955_0809401 3300035172 Bacteria 576
69 Ga0373935_0379376 3300035692 Bacteria 1012
70 Ga0373927_0018095 3300035695 Bacteria 4634
71 Ga0373925_0531628 3300037068 Unclassified 966
72 Ga0395898_1133005 3300037466 Unclassified 715
73 Ga0436365_1744908 3300039437 Bacteria 3347
74 Ga0451793_1363949 3300041452 Bacteria 1196
75 Ga0451795_0163353 3300041456 Bacteria 662
76 Ga0451802_1125176 3300041460 Bacteria 1619
77 Ga0451807_1575628 3300041486 Bacteria 738
78 Ga0451833_0426616 3300041491 Bacteria 994
79 Ga0451847_0070980 3300041503 Bacteria 721
80 Ga0466958_0177007 3300045836 Bacteria 1353
81 Ga0466967_1175150 3300045976 Bacteria 764
82 Ga0466967_1551930 3300045976 Bacteria 659
83 Ga0495603_0320479 3300046455 Bacteria 890
84 Ga0495580_0097553 3300046472 Unclassified 2044
85 Ga0495639_0039881 3300046475 Unclassified 2112
86 Ga0495662_0223602 3300046476 Unclassified 928
87 Ga0495585_0486823 3300046492 Bacteria 587
88 Ga0495596_0117227 3300046500 Bacteria 1034
89 Ga0495630_0183652 3300046517 Unclassified 1595
90 Ga0495630_0571739 3300046517 Bacteria 867
91 Ga0495632_0387633 3300046519 Bacteria 611
92 Ga0495645_0137341 3300046543 Bacteria 1709
93 Ga0495633_0237890 3300046558 Bacteria 832
94 Ga0495667_0101141 3300046559 Bacteria 1865
95 Ga0495656_0134579 3300046615 Bacteria 1179
96 Ga0495668_0077369 3300046616 Bacteria 1826
97 Ga0495625_0509952 3300046660 Bacteria 734
98 Ga0495625_0663237 3300046660 Bacteria 620
99 Ga0495599_0865284 3300046678 Unclassified 514
100 Ga0495658_0135451 3300046683 Bacteria 1502
101 Ga0495669_0212630 3300046684 Bacteria 926
102 Ga0495613_0481963 3300046689 Unclassified 837
103 Ga0495671_0211478 3300046692 Bacteria 940
104 Ga0495672_0147844 3300047320 Unclassified 1221
105 Ga0495672_0192855 3300047320 Bacteria 1023
106 Ga0495672_0278620 3300047320 Bacteria 800
107 Ga0495673_0090388 3300047469 Bacteria 1252
108 Ga0495673_0113590 3300047469 Bacteria 1080
109 Ga0495673_0119894 3300047469 Bacteria 1043
110 Ga0495681_0321317 3300047470 Bacteria 594
111 Ga0495593_0226387 3300047673 Unclassified 938
112 Ga0495614_0483817 3300048089 Unclassified 588
113 Ga0496112_0000029 3300048915 Bacteria 122291
114 Ga0496114_0222828 3300048917 Bacteria 1656
115 Ga0496118_0069725 3300048921 Bacteria 2544
116 Ga0496119_0286185 3300048922 Bacteria 818
117 Ga0496120_0440521 3300048923 Bacteria 569
118 Ga0496124_0071730 3300048927 Bacteria 2870
119 Ga0501031_0162787 3300049568 Bacteria 1458
120 Ga0501036_0254330 3300049572 Bacteria 1472
121 Ga0501038_0018654 3300049574 Bacteria 6266
122 Ga0501042_0149379 3300049578 Bacteria 1685
123 Ga0501048_0191112 3300049582 Bacteria 1451
124 Ga0501072_0028585 3300049588 Bacteria 4353
125 Ga0501080_0555424 3300049742 Bacteria 1022
126 Ga0501083_0226560 3300049744 Bacteria 1217
127 Ga0501035_0138613 3300049822 Bacteria 2116
128 Ga0501044_0568326 3300049823 Bacteria 1029
129 nmdc:mga0yw44_259301_c1 3300050492 Unclassified 1158
130 nmdc:mga06z11_211489_c1 3300050494 Bacteria 1130
131 nmdc:mga05p37_419_c1 3300050507 Bacteria 45960
132 nmdc:mga09592_570_c1 3300050508 Bacteria 27977
133 nmdc:mga0qj67_24041_c1 3300050509 Bacteria 4694
134 nmdc:mga06r32_453_c1 3300050510 Bacteria 34927
135 nmdc:mga08y16_6524_c1 3300050511 Bacteria 12238
136 nmdc:mga0sz30_100161_c1 3300050516 Bacteria 1265
137 Ga0495601_0892971 3300053077 Unclassified 562
138 Ga0495612_0229418 3300053078 Bacteria 823
139 Ga0495612_0408915 3300053078 Unclassified 617
140 Ga0495619_0313371 3300053085 Unclassified 1087
141 Ga0500646_0204432 3300053090 Bacteria 679
142 Ga0500583_0477721 3300053092 Bacteria 588
143 Ga0500651_0625214 3300053093 Bacteria 582
144 Ga0500641_0015705 3300053096 Bacteria 2815
145 Ga0500556_0367516 3300053104 Unclassified 555
146 Ga0500595_018610 3300053119 Bacteria 2537
147 Ga0500658_0047424 3300053134 Bacteria 1744
148 Ga0500658_0060825 3300053134 Bacteria 1570
149 Ga0500561_0301803 3300053137 Bacteria 511
150 Ga0500568_0103555 3300053139 Bacteria 1067
151 Ga0500627_0266254 3300053158 Bacteria 755
152 Ga0500634_0089062 3300053161 Bacteria 1571
153 Ga0501084_0265269 3300054114 Bacteria 1450
154 Ga0501084_0398349 3300054114 Bacteria 1163
155 Ga0501084_1454321 3300054114 Unclassified 574
156 Ga0530510_1027866 3300061734 Unclassified 631
157 2508696267 2508501042 Bacteria 8719808
158 2524465335 2524023210 Bacteria 9029266
159 2935614430 2935608549 Bacteria 8203142
160 2935826648 2935819856 Bacteria 8261050
161 2935851058 2935847175 Bacteria 8228321
162 2935985736 2935984226 Bacteria 8302647
163 8056681598 8056681323 Bacteria 8472857
164 Ga0070665_100062522
165 JGI25406J46586_10006858
166 Ga0055526_1068533
167 Ga0065165_1106798
168 Ga0065704_10499132
169 Ga0070680_100991766
170 Ga0070674_100845215
171 Ga0070667_101497507
172 Ga0070714_100088775
173 Ga0070663_100924962
174 Ga0070665_100358730
175 Ga0068859_100338964
176 Ga0068860_100000411
177 Ga0081538_10014582
178 Ga0081540_1133879
179 Ga0081539_10011052
180 Ga0070717_10235465
181 Ga0070717_11670588
182 Ga0075365_10230699
183 Ga0075365_10249631
184 Ga0075367_10185424
185 Ga0075367_10865251
186 Ga0075428_100000580
187 Ga0075430_100028026
188 Ga0075431_100000518
189 Ga0075429_100005751
190 Ga0075436_100748098
191 Ga0097620_100338966
192 Ga0099795_10128601
193 Ga0099795_10158868
194 Ga0111539_10000651
195 Ga0114129_10019741
196 Ga0105243_10443116
197 Ga0105238_11668517
198 Ga0099796_10025681
199 Ga0105239_11735184
200 Ga0157378_11690290
201 Ga0163162_12063489
202 Ga0157375_11964631
203 Ga0157380_12026872
204 Ga0157380_12824715
205 Ga0157379_11396842
206 Ga0209256_1058120
207 Ga0207694_11467058
208 Ga0207664_10488800
209 Ga0207686_10600038
210 Ga0207669_10253398
211 Ga0207704_11538524
212 Ga0207640_10180717
213 Ga0207658_11149110
214 Ga0207698_10614700
215 Ga0209179_1116312
216 Ga0207428_10002244
217 Ga0268264_10000194
218 Ga0307517_10365322
219 Ga0307517_10575657
220 Ga0265316_10119992
221 Ga0307516_10014504
222 Ga0307516_10380912
223 Ga0307406_10604024
224 Ga0307409_102146502
225 Ga0307510_10160109
226 Ga0373934_0050094
227 Ga0373939_0001981
228 Ga0373957_0190290
229 Ga0373943_0417166
230 Ga0373955_0057716
231 Ga0373955_0809401
232 Ga0373935_0379376
233 Ga0373927_0018095
234 Ga0373925_0531628
235 Ga0395898_1133005
236 Ga0436365_1744908
237 Ga0451793_1363949
238 Ga0451795_0163353
239 Ga0451802_1125176
240 Ga0451807_1575628
241 Ga0451833_0426616
242 Ga0451847_0070980
243 Ga0466958_0177007
244 Ga0466967_1175150
245 Ga0466967_1551930
246 Ga0495603_0320479
247 Ga0495580_0097553
248 Ga0495639_0039881
249 Ga0495662_0223602
250 Ga0495585_0486823
251 Ga0495596_0117227
252 Ga0495630_0183652
253 Ga0495630_0571739
254 Ga0495632_0387633
255 Ga0495645_0137341
256 Ga0495633_0237890
257 Ga0495667_0101141
258 Ga0495656_0134579
259 Ga0495668_0077369
260 Ga0495625_0509952
261 Ga0495625_0663237
262 Ga0495599_0865284
263 Ga0495658_0135451
264 Ga0495669_0212630
265 Ga0495613_0481963
266 Ga0495671_0211478
267 Ga0495672_0147844
268 Ga0495672_0192855
269 Ga0495672_0278620
270 Ga0495673_0090388
271 Ga0495673_0113590
272 Ga0495673_0119894
273 Ga0495681_0321317
274 Ga0495593_0226387
275 Ga0495614_0483817
276 Ga0496112_0000029
277 Ga0496114_0222828
278 Ga0496118_0069725
279 Ga0496119_0286185
280 Ga0496120_0440521
281 Ga0496124_0071730
282 Ga0501031_0162787
283 Ga0501036_0254330
284 Ga0501038_0018654
285 Ga0501042_0149379
286 Ga0501048_0191112
287 Ga0501072_0028585
288 Ga0501080_0555424
289 Ga0501083_0226560
290 Ga0501035_0138613
291 Ga0501044_0568326
292 nmdc:mga0yw44_259301_c1
293 nmdc:mga06z11_211489_c1
294 nmdc:mga05p37_419_c1
295 nmdc:mga09592_570_c1
296 nmdc:mga0qj67_24041_c1
297 nmdc:mga06r32_453_c1
298 nmdc:mga08y16_6524_c1
299 nmdc:mga0sz30_100161_c1
300 Ga0495601_0892971
301 Ga0495612_0229418
302 Ga0495612_0408915
303 Ga0495619_0313371
304 Ga0500646_0204432
305 Ga0500583_0477721
306 Ga0500651_0625214
307 Ga0500641_0015705
308 Ga0500556_0367516
309 Ga0500595_018610
310 Ga0500658_0047424
311 Ga0500658_0060825
312 Ga0500561_0301803
313 Ga0500568_0103555
314 Ga0500627_0266254
315 Ga0500634_0089062
316 Ga0501084_0265269
317 Ga0501084_0398349
318 Ga0501084_1454321
319 Ga0530510_1027866
320 2508696267
321 2524465335
322 2935614430
323 2935826648
324 2935851058
325 2935985736
326 8056681598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05016

ParE_toxin

ParE toxin of type II toxin-antitoxin system, parDE

3

92

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ycu-assembly1.cif.gz_C-2 heterotetramer of antitoxin prpa together with toxin prpt from pseudoalteromonas rubra 0.9081 3 91
3kxe-assembly1.cif.gz_B a conserved mode of protein recognition and binding in a pard-pare toxin-antitoxin complex 0.907 1 91
5czf-assembly2.cif.gz_C crystal structure of the paaa2-pare2 antitoxin-toxin complex 0.9057 1 91
8c24-assembly1.cif.gz_B parde1 toxin-antitoxin complex from mycobacterium tuberculosis (rv1960c-rv1959c) 0.8964 1 92
5ceg-assembly1.cif.gz_B x-ray structure of toxin/anti-toxin complex from mesorhizobium opportunistum 0.8881 1 92
ID Description Score Start End Superfamily
af_P9WHG7_1_98_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9291 3 91 3.30.2310.20
5cegD00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9066 1 91 3.30.2310.20
3kxeB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8993 1 91 3.30.2310.20
5cw7F00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8917 1 91 3.30.2310.20
af_Q9EP82_139_321_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8696 59 87 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A323ULH1-F1-model_v4 Type II toxin-antitoxin system RelE/ParE family toxin 0.9922 1 90
AF-A0A2N3DRI6-F1-model_v4 Plasmid stabilization protein ParE 0.9658 1 90
AF-A0A0Q6PP12-F1-model_v4 Plasmid stabilization protein 0.9656 1 87
AF-A0A2S6BDT0-F1-model_v4 deleted 0.9609 1 91
AF-A0A327KW17-F1-model_v4 Plasmid stabilization protein 0.9595 1 92

Map