F240721

General Info

Members Datasets Scaffolds Average Seq Length
163 123 163 130

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10098506|Ga0065704_100985063
Length 145
Sequence MERIVTTEIGDQRMLRFIGMRINSAKDLNVYKVGYERAMKIFEVSKRFPPEERFALTSQIRRSSRSVCLNLREAWAKRRYEGHFISKLTDCDGENSETDSSLDFARDCKYISAERHAELVALCEEIGRMLGGMIRNPTSFLVTNR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
110 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
121 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
122 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1035609 2162886007 Unclassified 1182
2 Ga0065704_10098506 3300005289 Unclassified 2350
3 Ga0065704_10348353 3300005289 Bacteria 813
4 Ga0065715_10272133 3300005293 Bacteria 1088
5 Ga0065707_10029033 3300005295 Bacteria 1462
6 Ga0065707_10125886 3300005295 Unclassified 2014
7 Ga0065707_10842018 3300005295 Bacteria 585
8 Ga0070658_10359087 3300005327 Unclassified 1247
9 Ga0070676_10365605 3300005328 Unclassified 995
10 Ga0070683_101086386 3300005329 Unclassified 768
11 Ga0070690_100965323 3300005330 Unclassified 670
12 Ga0070690_101090015 3300005330 Bacteria 633
13 Ga0070670_102080104 3300005331 Unclassified 523
14 Ga0068869_100018178 3300005334 Unclassified 4780
15 Ga0070666_10490997 3300005335 Bacteria 889
16 Ga0070680_100218140 3300005336 Bacteria 1610
17 Ga0070682_100117171 3300005337 Bacteria 1783
18 Ga0068868_100348531 3300005338 Bacteria 1268
19 Ga0070661_100357216 3300005344 Bacteria 1147
20 Ga0070692_10105715 3300005345 Bacteria 1550
21 Ga0070673_100068571 3300005364 Bacteria 2841
22 Ga0070688_100179681 3300005365 Bacteria 1467
23 Ga0070667_100737246 3300005367 Bacteria 913
24 Ga0070667_101344248 3300005367 Bacteria 670
25 Ga0070713_100786564 3300005436 Bacteria 912
26 Ga0070711_100605030 3300005439 Bacteria 915
27 Ga0070705_100854928 3300005440 Unclassified 728
28 Ga0070694_100421886 3300005444 Bacteria 1048
29 Ga0070694_100844959 3300005444 Bacteria 753
30 Ga0070708_100096341 3300005445 Bacteria 2702
31 Ga0070708_101959791 3300005445 Bacteria 543
32 Ga0070681_10204224 3300005458 Bacteria 1893
33 Ga0070706_100347923 3300005467 Bacteria 1382
34 Ga0070706_100739440 3300005467 Bacteria 911
35 Ga0070707_100026681 3300005468 Bacteria 5487
36 Ga0070707_100314273 3300005468 Bacteria 1522
37 Ga0070707_100873399 3300005468 Bacteria 864
38 Ga0070707_102134586 3300005468 Bacteria 528
39 Ga0070698_100000201 3300005471 Bacteria 57441
40 Ga0070698_100094193 3300005471 Bacteria 2974
41 Ga0070699_100000079 3300005518 Bacteria 92794
42 Ga0070699_100104763 3300005518 Bacteria 2481
43 Ga0070679_100068958 3300005530 Bacteria 3527
44 Ga0070684_100723424 3300005535 Bacteria 928
45 Ga0070697_100237889 3300005536 Bacteria 1554
46 Ga0068853_100000006 3300005539 Bacteria 295921
47 Ga0070672_101391930 3300005543 Unclassified 627
48 Ga0070686_100034668 3300005544 Bacteria 3112
49 Ga0070695_100493822 3300005545 Bacteria 945
50 Ga0070696_100007466 3300005546 Bacteria 7313
51 Ga0070665_100607514 3300005548 Unclassified 1107
52 Ga0070704_100003964 3300005549 Bacteria 8531
53 Ga0070704_100351245 3300005549 Bacteria 1245
54 Ga0070704_101593886 3300005549 Bacteria 602
55 Ga0070664_100689287 3300005564 Unclassified 951
56 Ga0068854_100043682 3300005578 Bacteria 3178
57 Ga0068856_100390883 3300005614 Bacteria 1410
58 Ga0068864_100213483 3300005618 Bacteria 1778
59 Ga0068866_10210903 3300005718 Bacteria 1166
60 Ga0068861_100071459 3300005719 Unclassified 2690
61 Ga0068863_101269003 3300005841 Bacteria 743
62 Ga0068860_100219239 3300005843 Unclassified 1847
63 Ga0070717_11026757 3300006028 Unclassified 751
64 Ga0070715_10349496 3300006163 Bacteria 807
65 Ga0070715_10681574 3300006163 Unclassified 612
66 Ga0070716_100181128 3300006173 Bacteria 1383
67 Ga0075428_100760466 3300006844 Bacteria 1031
68 Ga0075428_100999685 3300006844 Unclassified 885
69 Ga0075430_101141398 3300006846 Unclassified 642
70 Ga0075433_10193874 3300006852 Bacteria 1807
71 Ga0075434_100699907 3300006871 Bacteria 1031
72 Ga0075436_101018172 3300006914 Bacteria 622
73 Ga0099794_10589912 3300007265 Bacteria 588
74 Ga0105245_10065435 3300009098 Unclassified 3288
75 Ga0114129_10026647 3300009147 Bacteria 8187
76 Ga0114129_10967576 3300009147 Bacteria 1074
77 Ga0114129_11656897 3300009147 Unclassified 782
78 Ga0105241_10978548 3300009174 Bacteria 790
79 Ga0105242_10405568 3300009176 Unclassified 1273
80 Ga0105238_10939103 3300009551 Bacteria 884
81 Ga0105249_10044135 3300009553 Unclassified 4055
82 Ga0105239_10028211 3300010375 Bacteria 6174
83 Ga0105239_10650842 3300010375 Bacteria 1204
84 Ga0157342_1037636 3300012507 Unclassified 635
85 Ga0157369_10566134 3300013105 Unclassified 1174
86 Ga0157374_10532503 3300013296 Bacteria 1181
87 Ga0157374_11000316 3300013296 Unclassified 855
88 Ga0157378_10047823 3300013297 Bacteria 3803
89 Ga0157378_10117793 3300013297 Bacteria 2444
90 Ga0157378_11202324 3300013297 Bacteria 797
91 Ga0157378_11524203 3300013297 Bacteria 713
92 Ga0157378_12645146 3300013297 Bacteria 554
93 Ga0163162_10018794 3300013306 Bacteria 6775
94 Ga0163162_13076897 3300013306 Bacteria 536
95 Ga0157372_11244032 3300013307 Bacteria 860
96 Ga0157375_12495123 3300013308 Bacteria 617
97 Ga0157376_10315339 3300014969 Bacteria 1485
98 Ga0207697_10014847 3300025315 Bacteria 3226
99 Ga0207642_10132925 3300025899 Bacteria 1301
100 Ga0207688_10082432 3300025901 Bacteria 1838
101 Ga0207680_10155312 3300025903 Bacteria 1529
102 Ga0207645_10159570 3300025907 Unclassified 1475
103 Ga0207645_10836113 3300025907 Unclassified 626
104 Ga0207705_10443637 3300025909 Unclassified 1006
105 Ga0207705_10699807 3300025909 Unclassified 788
106 Ga0207684_10231172 3300025910 Bacteria 1595
107 Ga0207684_10437045 3300025910 Bacteria 1124
108 Ga0207684_10646893 3300025910 Bacteria 901
109 Ga0207654_10453025 3300025911 Bacteria 900
110 Ga0207660_10361831 3300025917 Bacteria 1164
111 Ga0207652_10896993 3300025921 Unclassified 783
112 Ga0207646_10008614 3300025922 Bacteria 10194
113 Ga0207646_10295236 3300025922 Bacteria 1464
114 Ga0207646_10316584 3300025922 Bacteria 1410
115 Ga0207650_10681924 3300025925 Bacteria 867
116 Ga0207650_11346489 3300025925 Bacteria 607
117 Ga0207644_10693358 3300025931 Unclassified 849
118 Ga0207686_10529263 3300025934 Unclassified 918
119 Ga0207665_10089485 3300025939 Bacteria 2132
120 Ga0207689_10008406 3300025942 Bacteria 8987
121 Ga0207661_10930944 3300025944 Unclassified 800
122 Ga0207651_10246910 3300025960 Bacteria 1458
123 Ga0207712_10139821 3300025961 Unclassified 1856
124 Ga0207640_10217304 3300025981 Bacteria 1461
125 Ga0207640_10236337 3300025981 Unclassified 1409
126 Ga0207658_10965765 3300025986 Bacteria 777
127 Ga0207677_10367899 3300026023 Bacteria 1210
128 Ga0207677_10611374 3300026023 Unclassified 957
129 Ga0207639_10000001 3300026041 Bacteria 1431562
130 Ga0207702_11709668 3300026078 Unclassified 622
131 Ga0207641_12554276 3300026088 Unclassified 509
132 Ga0207648_10104125 3300026089 Unclassified 2489
133 Ga0207675_100002039 3300026118 Bacteria 20154
134 Ga0207675_100225958 3300026118 Bacteria 1805
135 Ga0207683_10155989 3300026121 Bacteria 2062
136 Ga0268266_10983378 3300028379 Unclassified 816
137 Ga0268264_10183543 3300028381 Unclassified 1902
138 Ga0265322_10206873 3300028654 Bacteria 562
139 Ga0265338_10049633 3300028800 Bacteria 3802
140 Ga0265332_10084642 3300031238 Bacteria 1344
141 Ga0265325_10381462 3300031241 Bacteria 619
142 Ga0265316_10058422 3300031344 Bacteria 3005
143 Ga0265316_10394880 3300031344 Unclassified 997
144 Ga0265316_10636065 3300031344 Bacteria 755
145 Ga0265313_10065193 3300031595 Bacteria 1692
146 Ga0265314_10365452 3300031711 Bacteria 790
147 Ga0307406_10701050 3300031901 Bacteria 845
148 Ga0242420_013717 3300038996 Unclassified 1383
149 Ga0451577_2003030 3300042876 Bacteria 506
150 Ga0453683_0156275 3300044673 Bacteria 1442
151 Ga0453684_1897848 3300044712 Bacteria 603
152 Ga0451576_0226625 3300045051 Bacteria 1952
153 Ga0501071_0575990 3300049587 Unclassified 865
154 Ga0501075_0598360 3300049591 Bacteria 841
155 Ga0501044_0381168 3300049823 Bacteria 1325
156 nmdc:mga05p37_1205350_c1 3300050507 Unclassified 782
157 nmdc:mga05p37_43157_c1 3300050507 Bacteria 5546
158 nmdc:mga05p37_617508_c1 3300050507 Archaea 1220
159 nmdc:mga09592_121044_c1 3300050508 Bacteria 2248
160 nmdc:mga0n895_692498_c1 3300050512 Bacteria 1015
161 nmdc:mga0rr50_701839_c1 3300050513 Bacteria 863
162 nmdc:mga0a205_839953_c1 3300050515 Unclassified 766
163 Ga0501082_1284630 3300060353 Bacteria 639

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10348353 Ga0065704_103483532 116
2 3300026041 Ga0207639_10000001 Ga0207639_100000011113 117
3 3300026118 Ga0207675_100225958 Ga0207675_1002259581 118
4 3300005293 Ga0065715_10272133 Ga0065715_102721332 119
5 3300005295 Ga0065707_10029033 Ga0065707_100290332 119
6 3300007265 Ga0099794_10589912 Ga0099794_105899121 120
7 3300005444 Ga0070694_100421886 Ga0070694_1004218862 122
8 3300005518 Ga0070699_100000079 Ga0070699_10000007912 124
9 3300005546 Ga0070696_100007466 Ga0070696_1000074667 124
10 3300005564 Ga0070664_100689287 Ga0070664_1006892871 124
11 3300006844 Ga0075428_100999685 Ga0075428_1009996852 124
12 3300006846 Ga0075430_101141398 Ga0075430_1011413981 124
13 3300049587 Ga0501071_0575990 Ga0501071_0575990_24_398 124
14 3300049591 Ga0501075_0598360 Ga0501075_0598360_287_661 124
15 3300005329 Ga0070683_101086386 Ga0070683_1010863861 125
16 3300005330 Ga0070690_100965323 Ga0070690_1009653231 125
17 3300005335 Ga0070666_10490997 Ga0070666_104909971 125
18 3300005336 Ga0070680_100218140 Ga0070680_1002181402 125
19 3300005337 Ga0070682_100117171 Ga0070682_1001171712 125
20 3300005338 Ga0068868_100348531 Ga0068868_1003485312 125
21 3300005344 Ga0070661_100357216 Ga0070661_1003572162 125
22 3300005364 Ga0070673_100068571 Ga0070673_1000685712 125
23 3300005365 Ga0070688_100179681 Ga0070688_1001796812 125
24 3300005367 Ga0070667_100737246 Ga0070667_1007372462 125
25 3300005458 Ga0070681_10204224 Ga0070681_102042242 125
26 3300005468 Ga0070707_100026681 Ga0070707_1000266815 125
27 3300005468 Ga0070707_100873399 Ga0070707_1008733991 125
28 3300005471 Ga0070698_100000201 Ga0070698_10000020112 125
29 3300005518 Ga0070699_100104763 Ga0070699_1001047632 125
30 3300005530 Ga0070679_100068958 Ga0070679_1000689584 125
31 3300005535 Ga0070684_100723424 Ga0070684_1007234242 125
32 3300005543 Ga0070672_101391930 Ga0070672_1013919301 125
33 3300005544 Ga0070686_100034668 Ga0070686_1000346682 125
34 3300005549 Ga0070704_100003964 Ga0070704_1000039644 125
35 3300005614 Ga0068856_100390883 Ga0068856_1003908832 125
36 3300005618 Ga0068864_100213483 Ga0068864_1002134832 125
37 3300006163 Ga0070715_10349496 Ga0070715_103494962 125
38 3300010375 Ga0105239_10650842 Ga0105239_106508422 125
39 3300013105 Ga0157369_10566134 Ga0157369_105661342 125
40 3300013296 Ga0157374_11000316 Ga0157374_110003161 125
41 3300013307 Ga0157372_11244032 Ga0157372_112440322 125
42 3300014969 Ga0157376_10315339 Ga0157376_103153392 125
43 3300025315 Ga0207697_10014847 Ga0207697_100148472 125
44 3300025901 Ga0207688_10082432 Ga0207688_100824321 125
45 3300025903 Ga0207680_10155312 Ga0207680_101553122 125
46 3300025909 Ga0207705_10443637 Ga0207705_104436371 125
47 3300025911 Ga0207654_10453025 Ga0207654_104530252 125
48 3300025917 Ga0207660_10361831 Ga0207660_103618312 125
49 3300025921 Ga0207652_10896993 Ga0207652_108969931 125
50 3300025922 Ga0207646_10008614 Ga0207646_100086146 125
51 3300025922 Ga0207646_10316584 Ga0207646_103165842 125
52 3300025944 Ga0207661_10930944 Ga0207661_109309441 125
53 3300025960 Ga0207651_10246910 Ga0207651_102469102 125
54 3300026023 Ga0207677_10367899 Ga0207677_103678992 125
55 3300026078 Ga0207702_11709668 Ga0207702_117096681 125
56 3300026121 Ga0207683_10155989 Ga0207683_101559892 125
57 3300028379 Ga0268266_10983378 Ga0268266_109833781 125
58 3300060353 Ga0501082_1284630 Ga0501082_1284630_64_441 125
59 3300005295 Ga0065707_10842018 Ga0065707_108420181 126
60 3300005327 Ga0070658_10359087 Ga0070658_103590873 126
61 3300005330 Ga0070690_101090015 Ga0070690_1010900151 126
62 3300005345 Ga0070692_10105715 Ga0070692_101057151 126
63 3300005436 Ga0070713_100786564 Ga0070713_1007865642 126
64 3300005439 Ga0070711_100605030 Ga0070711_1006050302 126
65 3300005444 Ga0070694_100844959 Ga0070694_1008449592 126
66 3300005445 Ga0070708_100096341 Ga0070708_1000963412 126
67 3300005467 Ga0070706_100347923 Ga0070706_1003479231 126
68 3300005467 Ga0070706_100739440 Ga0070706_1007394402 126
69 3300005468 Ga0070707_100314273 Ga0070707_1003142731 126
70 3300005468 Ga0070707_102134586 Ga0070707_1021345861 126
71 3300005471 Ga0070698_100094193 Ga0070698_1000941933 126
72 3300005536 Ga0070697_100237889 Ga0070697_1002378892 126
73 3300005539 Ga0068853_100000006 Ga0068853_100000006216 126
74 3300005545 Ga0070695_100493822 Ga0070695_1004938222 126
75 3300005549 Ga0070704_100351245 Ga0070704_1003512452 126
76 3300005549 Ga0070704_101593886 Ga0070704_1015938861 126
77 3300005841 Ga0068863_101269003 Ga0068863_1012690032 126
78 3300006028 Ga0070717_11026757 Ga0070717_110267572 126
79 3300006163 Ga0070715_10681574 Ga0070715_106815741 126
80 3300006173 Ga0070716_100181128 Ga0070716_1001811282 126
81 3300006844 Ga0075428_100760466 Ga0075428_1007604661 126
82 3300006914 Ga0075436_101018172 Ga0075436_1010181721 126
83 3300009147 Ga0114129_10026647 Ga0114129_100266475 126
84 3300009174 Ga0105241_10978548 Ga0105241_109785482 126
85 3300009551 Ga0105238_10939103 Ga0105238_109391032 126
86 3300013297 Ga0157378_11202324 Ga0157378_112023242 126
87 3300013297 Ga0157378_11524203 Ga0157378_115242032 126
88 3300013297 Ga0157378_12645146 Ga0157378_126451461 126
89 3300013306 Ga0163162_13076897 Ga0163162_130768972 126
90 3300025909 Ga0207705_10699807 Ga0207705_106998072 126
91 3300025910 Ga0207684_10231172 Ga0207684_102311722 126
92 3300025910 Ga0207684_10437045 Ga0207684_104370452 126
93 3300025910 Ga0207684_10646893 Ga0207684_106468932 126
94 3300025922 Ga0207646_10295236 Ga0207646_102952362 126
95 3300025925 Ga0207650_11346489 Ga0207650_113464891 126
96 3300025939 Ga0207665_10089485 Ga0207665_100894852 126
97 3300026088 Ga0207641_12554276 Ga0207641_125542761 126
98 3300028654 Ga0265322_10206873 Ga0265322_102068731 126
99 3300028800 Ga0265338_10049633 Ga0265338_100496334 126
100 3300031238 Ga0265332_10084642 Ga0265332_100846422 126
101 3300031241 Ga0265325_10381462 Ga0265325_103814621 126
102 3300031344 Ga0265316_10058422 Ga0265316_100584223 126
103 3300031344 Ga0265316_10394880 Ga0265316_103948801 126
104 3300031344 Ga0265316_10636065 Ga0265316_106360652 126
105 3300031595 Ga0265313_10065193 Ga0265313_100651932 126
106 3300031711 Ga0265314_10365452 Ga0265314_103654521 126
107 3300031901 Ga0307406_10701050 Ga0307406_107010501 126
108 3300042876 Ga0451577_2003030 Ga0451577_2003030_104_487 126
109 3300044712 Ga0453684_1897848 Ga0453684_1897848_116_517 126
110 3300045051 Ga0451576_0226625 Ga0451576_0226625_1523_1906 126
111 3300049823 Ga0501044_0381168 Ga0501044_0381168_239_622 126
112 3300050507 nmdc:mga05p37_43157_c1 nmdc:mga05p37_43157_c1_2381_2788 126
113 3300050507 nmdc:mga05p37_617508_c1 nmdc:mga05p37_617508_c1_676_1056 126
114 3300050508 nmdc:mga09592_121044_c1 nmdc:mga09592_121044_c1_482_862 126
115 3300050513 nmdc:mga0rr50_701839_c1 nmdc:mga0rr50_701839_c1_381_782 126
116 3300005328 Ga0070676_10365605 Ga0070676_103656052 128
117 3300005331 Ga0070670_102080104 Ga0070670_1020801041 128
118 3300005367 Ga0070667_101344248 Ga0070667_1013442482 128
119 3300005548 Ga0070665_100607514 Ga0070665_1006075141 128
120 3300013296 Ga0157374_10532503 Ga0157374_105325032 128
121 3300013308 Ga0157375_12495123 Ga0157375_124951232 128
122 3300025907 Ga0207645_10836113 Ga0207645_108361131 128
123 3300025925 Ga0207650_10681924 Ga0207650_106819241 128
124 3300025931 Ga0207644_10693358 Ga0207644_106933582 128
125 3300025986 Ga0207658_10965765 Ga0207658_109657651 128
126 3300005445 Ga0070708_101959791 Ga0070708_1019597911 129
127 3300006871 Ga0075434_100699907 Ga0075434_1006999072 132
128 3300009147 Ga0114129_10967576 Ga0114129_109675761 132
129 3300050512 nmdc:mga0n895_692498_c1 nmdc:mga0n895_692498_c1_425_859 132
130 3300005334 Ga0068869_100018178 Ga0068869_1000181786 135
131 3300005440 Ga0070705_100854928 Ga0070705_1008549281 135
132 3300005719 Ga0068861_100071459 Ga0068861_1000714593 135
133 3300009098 Ga0105245_10065435 Ga0105245_100654352 135
134 3300009176 Ga0105242_10405568 Ga0105242_104055682 135
135 3300009553 Ga0105249_10044135 Ga0105249_100441353 135
136 3300010375 Ga0105239_10028211 Ga0105239_100282119 135
137 3300012507 Ga0157342_1037636 Ga0157342_10376361 135
138 3300013297 Ga0157378_10117793 Ga0157378_101177932 135
139 3300013306 Ga0163162_10018794 Ga0163162_100187944 135
140 3300025907 Ga0207645_10159570 Ga0207645_101595701 135
141 3300025934 Ga0207686_10529263 Ga0207686_105292632 135
142 3300025942 Ga0207689_10008406 Ga0207689_100084066 135
143 3300025961 Ga0207712_10139821 Ga0207712_101398212 135
144 3300025981 Ga0207640_10236337 Ga0207640_102363372 135
145 3300026023 Ga0207677_10611374 Ga0207677_106113742 135
146 3300026089 Ga0207648_10104125 Ga0207648_101041252 135
147 3300026118 Ga0207675_100002039 Ga0207675_10000203912 135
148 3300038996 Ga0242420_013717 Ga0242420_013717_761_1183 135
149 3300044673 Ga0453683_0156275 Ga0453683_0156275_559_981 135
150 3300005578 Ga0068854_100043682 Ga0068854_1000436823 136
151 3300005718 Ga0068866_10210903 Ga0068866_102109032 136
152 3300005843 Ga0068860_100219239 Ga0068860_1002192393 136
153 3300006852 Ga0075433_10193874 Ga0075433_101938742 136
154 3300009147 Ga0114129_11656897 Ga0114129_116568972 136
155 3300013297 Ga0157378_10047823 Ga0157378_100478232 136
156 3300025899 Ga0207642_10132925 Ga0207642_101329252 136
157 3300025981 Ga0207640_10217304 Ga0207640_102173042 136
158 3300028381 Ga0268264_10183543 Ga0268264_101835432 136
159 3300050507 nmdc:mga05p37_1205350_c1 nmdc:mga05p37_1205350_c1_201_611 136
160 3300050515 nmdc:mga0a205_839953_c1 nmdc:mga0a205_839953_c1_291_701 136
161 2162886007 SwRhRL2b_contig_1035609 SwRhRL2b_0109.00006730 145
162 3300005289 Ga0065704_10098506 Ga0065704_100985063 145
163 3300005295 Ga0065707_10125886 Ga0065707_101258862 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

26

132

0.97

PF22296

Bbp7-like

Bbp7-like

30

137

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9714 25 135
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9561 25 135
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9287 25 135
4dwl-assembly1.cif.gz_D avd molecule from bordetella bacteriophage dgr 0.9119 28 139
2gsc-assembly1.cif.gz_D crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9083 25 135
ID Description Score Start End Superfamily
af_A0A1D6PIN9_172_240_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9902 82 134 1.10.287.660
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9714 25 135 1.20.1440.60
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9583 23 139 1.20.1440.60
2gscA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9419 23 139 1.20.1440.60
af_O96151_9_341_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.939 88 132 2.60.40.150
ID Description Score Start End GO Terms
AF-A0A7C7V2Z7-F1-model_v4 Four helix bundle protein 1.003 33 144
AF-X0V1P4-F1-model_v4 Four helix bundle protein 1.002 59 144
AF-A0A2V6H3R1-F1-model_v4 Diversity-generating retroelement protein bAvd family protein 1.001 20 144
AF-X0ZU29-F1-model_v4 Four helix bundle protein 1.001 57 140
AF-A0A433VZ16-F1-model_v4 deleted 1 22 144

Feature Viewer

pLDDT pTM Quality
88.18 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map