F240255

General Info

Members Datasets Scaffolds Average Seq Length
162 134 324 541

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0046269|Ga0501033_0046269_527_2155
Length 537
Sequence MARIMDRLGAIHGATDAVVNKGTAFTHDERRRLRLEGLLPPRQESLEDQAARIIDNVRAQSEALEKYRYLSGIQAENETLFYRVVLDHLEELLPIIYTPTIGQACLEWSRIFVRPRGVYISAFRHRGRIAELLRNWPRHALVIVVTDGGRVLGLGDLGVNGMGIPIGKLALYTACAGIAPDRCLPVALDVGTDNTCLRHDPLYLGERQARMTGEAYEAVIDEFVMAAQTVCPGAVVQFEDFNNACAFALLARYRHRLCCFNDDVQGTGAMGLAGLSVAGRITGRALAEQRILFVGAGEACLGIGGLVVEAMQRAGVSEADARRQCLFVDSKGTVVTSRQDLAEHKRRFAQERPPLPDLLTTVETFTPTVLVGACGQSGVFTEPVMRAMARLNDRPIVFALSNPTSKAECTAEQAYRWTDGRAIFASGSPFDPVALNEALHIPGQGNNSFVFPGLGLGLMISGARRVTDDMFLAASRALTGHVTDADLVHGRVFPAPGRMRDVAVAASVAYEQGLATVPVPRDIAAEAERQMWVPSYA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
54 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
58 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
59 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
70 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
71 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
76 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
81 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
87 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
106 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
113 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
114 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
115 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
116 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
117 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
118 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
123 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
127 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
128 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
129 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
130 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
131 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
132 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
133 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
134 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.06
Metatranscriptomes 0
Isolates 4.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.73
Nodule 2.47
Rhizoplane 2.47
Rhizosphere 70.99
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0046269 3300049570 Unclassified 3235
2 rootH1_10078376 3300003323 Bacteria 3557
3 Ga0065707_10093933 3300005295 Bacteria 3560
4 Ga0068869_100002667 3300005334 Bacteria 10782
5 Ga0070709_10023361 3300005434 Bacteria 3628
6 Ga0070714_100091937 3300005435 Bacteria 2659
7 Ga0070713_100053920 3300005436 Bacteria 3333
8 Ga0070713_100070290 3300005436 Bacteria 2955
9 Ga0070710_10051971 3300005437 Bacteria 2303
10 Ga0070710_10059865 3300005437 Bacteria 2164
11 Ga0070711_100046486 3300005439 Bacteria 2958
12 Ga0070708_100007598 3300005445 Bacteria 8679
13 Ga0070681_10033312 3300005458 Bacteria 5172
14 Ga0070706_100165696 3300005467 Bacteria 2064
15 Ga0070707_100002829 3300005468 Bacteria 16509
16 Ga0070707_100175550 3300005468 Bacteria 2088
17 Ga0070698_100009076 3300005471 Bacteria 10688
18 Ga0070698_100025116 3300005471 Bacteria 6210
19 Ga0070698_100041638 3300005471 Bacteria 4715
20 Ga0070698_100044635 3300005471 Bacteria 4537
21 Ga0070698_100132832 3300005471 Bacteria 2444
22 Ga0070699_100035784 3300005518 Bacteria 4292
23 Ga0070697_100033080 3300005536 Bacteria 4163
24 Ga0068856_100052167 3300005614 Bacteria 4032
25 Ga0068860_100018201 3300005843 Bacteria 6838
26 Ga0068862_100047816 3300005844 Bacteria 3651
27 Ga0081540_1000981 3300005983 Bacteria 25742
28 Ga0081540_1001720 3300005983 Bacteria 18524
29 Ga0081540_1012314 3300005983 Bacteria 5644
30 Ga0081540_1015009 3300005983 Bacteria 4922
31 Ga0081540_1023902 3300005983 Bacteria 3560
32 Ga0070717_10057869 3300006028 Bacteria 3204
33 Ga0075365_10104196 3300006038 Bacteria 1945
34 Ga0070712_100030936 3300006175 Bacteria 3603
35 Ga0070712_100030946 3300006175 Bacteria 3602
36 Ga0070712_100058623 3300006175 Bacteria 2709
37 Ga0075367_10021600 3300006178 Bacteria 3599
38 Ga0075369_10019422 3300006186 Bacteria 2774
39 Ga0075366_10003702 3300006195 Bacteria 8112
40 Ga0075370_10009247 3300006353 Bacteria 5108
41 Ga0075434_100185657 3300006871 Bacteria 2100
42 Ga0099794_10009726 3300007265 Bacteria 4058
43 Ga0099795_10003552 3300007788 Bacteria 3880
44 Ga0105251_10003705 3300009011 Bacteria 10958
45 Ga0105240_10015686 3300009093 Bacteria 10286
46 Ga0099796_10004513 3300010159 Bacteria 3378
47 Ga0099796_10013210 3300010159 Bacteria 2353
48 Ga0105239_10032891 3300010375 Bacteria 5698
49 Ga0213872_10001469 3300021361 Bacteria 15306
50 Ga0213875_10013310 3300021388 Bacteria 4043
51 Ga0209257_1027754 3300025304 Bacteria 1878
52 Ga0207713_1027378 3300025735 Bacteria 2590
53 Ga0207692_10006530 3300025898 Bacteria 4734
54 Ga0207684_10166632 3300025910 Bacteria 1899
55 Ga0207707_10053367 3300025912 Bacteria 3519
56 Ga0207695_10050906 3300025913 Bacteria 4354
57 Ga0207695_10053758 3300025913 Bacteria 4209
58 Ga0207693_10027867 3300025915 Bacteria 4465
59 Ga0207693_10088583 3300025915 Bacteria 2426
60 Ga0207646_10031097 3300025922 Bacteria 4834
61 Ga0207646_10081595 3300025922 Bacteria 2891
62 Ga0207700_10128733 3300025928 Bacteria 2063
63 Ga0207665_10002809 3300025939 Bacteria 11667
64 Ga0207689_10003670 3300025942 Bacteria 13998
65 Ga0207668_10025970 3300025972 Bacteria 3797
66 Ga0207675_100008242 3300026118 Bacteria 9817
67 Ga0268265_10036070 3300028380 Bacteria 3619
68 Ga0268264_10038448 3300028381 Bacteria 3950
69 Ga0265338_10002615 3300028800 Bacteria 26586
70 Ga0307511_10000421 3300030521 Bacteria 45250
71 Ga0265328_10002341 3300031239 Bacteria 8540
72 Ga0265316_10037381 3300031344 Bacteria 3918
73 Ga0307509_10000113 3300031507 Bacteria 116711
74 Ga0307509_10009580 3300031507 Bacteria 12056
75 Ga0373929_0011866 3300035085 Bacteria 1648
76 Ga0373927_0002120 3300035695 Bacteria 14623
77 Ga0373933_0015815 3300035724 Bacteria 4210
78 Ga0373937_0038840 3300036401 Bacteria 4337
79 Ga0373925_0031028 3300037068 Bacteria 3925
80 Ga0436364_0694743 3300037853 Bacteria 61820
81 Ga0436365_0389695 3300039437 Bacteria 3365
82 Ga0436365_0665546 3300039437 Bacteria 19677
83 Ga0436365_0689750 3300039437 Bacteria 5911
84 Ga0436365_0832333 3300039437 Bacteria 6009
85 Ga0436361_0087449 3300039447 Bacteria 5283
86 Ga0436361_0325755 3300039447 Bacteria 54753
87 Ga0436361_0386610 3300039447 Bacteria 3204
88 Ga0436361_0915035 3300039447 Bacteria 2171
89 Ga0436363_0846232 3300039450 Bacteria 2501
90 Ga0436363_1303735 3300039450 Bacteria 3033
91 Ga0451576_0061796 3300045051 Bacteria 3906
92 Ga0495629_0000004 3300046459 Bacteria 433516
93 Ga0495638_0056227 3300046460 Bacteria 2442
94 Ga0495610_0007055 3300046512 Bacteria 7587
95 Ga0495620_0016850 3300046515 Bacteria 3655
96 Ga0495648_0003277 3300046524 Bacteria 14321
97 Ga0495640_0064793 3300046533 Bacteria 2469
98 Ga0495668_0038182 3300046616 Bacteria 2685
99 Ga0495635_0005380 3300046663 Bacteria 8910
100 Ga0495669_0044967 3300046684 Bacteria 1968
101 Ga0495600_0039766 3300046809 Bacteria 3063
102 Ga0495581_0011162 3300047315 Bacteria 5192
103 Ga0495672_0007245 3300047320 Bacteria 8368
104 Ga0495680_0000761 3300047322 Bacteria 36107
105 Ga0495680_0085497 3300047322 Bacteria 2375
106 Ga0495684_0067726 3300047471 Bacteria 2715
107 Ga0495593_0010150 3300047673 Bacteria 5450
108 Ga0496101_0023478 3300048904 Bacteria 4262
109 Ga0496102_0090148 3300048905 Bacteria 2837
110 Ga0496106_0049932 3300048909 Bacteria 3152
111 Ga0496110_0072105 3300048913 Bacteria 3064
112 Ga0496117_0000663 3300048920 Bacteria 55078
113 Ga0496118_0002560 3300048921 Bacteria 24324
114 Ga0496126_0000651 3300048929 Bacteria 64444
115 Ga0496126_0077426 3300048929 Bacteria 2948
116 Ga0501036_0008774 3300049572 Bacteria 8298
117 Ga0501038_0028064 3300049574 Bacteria 5001
118 Ga0501039_0013208 3300049575 Bacteria 6312
119 Ga0501040_0032656 3300049576 Unclassified 3523
120 Ga0501041_0000846 3300049577 Bacteria 16464
121 Ga0501042_0053463 3300049578 Unclassified 2881
122 Ga0501046_0001883 3300049580 Bacteria 19956
123 Ga0501068_0024621 3300049584 Bacteria 3536
124 Ga0501071_0009791 3300049587 Bacteria 6396
125 Ga0501072_0074909 3300049588 Unclassified 2676
126 Ga0501074_0106593 3300049590 Unclassified 2006
127 Ga0501075_0001350 3300049591 Bacteria 15939
128 Ga0501076_0001809 3300049592 Bacteria 14505
129 Ga0501077_0020292 3300049593 Bacteria 4205
130 Ga0501079_0001760 3300049741 Bacteria 15442
131 Ga0501080_0098156 3300049742 Unclassified 2719
132 Ga0501081_0011510 3300049743 Bacteria 5787
133 Ga0501045_0001673 3300049824 Bacteria 14911
134 nmdc:mga05p37_17906_c1 3300050507 Bacteria 8552
135 nmdc:mga0n895_202118_c1 3300050512 Bacteria 2017
136 nmdc:mga0n895_31226_c1 3300050512 Bacteria 5098
137 nmdc:mga08x19_37289_c1 3300050514 Bacteria 3085
138 nmdc:mga0sz30_11452_c1 3300050516 Bacteria 3425
139 Ga0495619_0046711 3300053085 Bacteria 2848
140 Ga0500566_0027820 3300053094 Bacteria 3308
141 Ga0500640_000204 3300053095 Bacteria 12795
142 Ga0500554_000004 3300053102 Bacteria 62632
143 Ga0500595_000600 3300053119 Bacteria 21474
144 Ga0500614_000029 3300053123 Bacteria 33165
145 Ga0500559_0025811 3300053136 Bacteria 2501
146 Ga0500564_025943 3300053138 Bacteria 2693
147 Ga0500568_0000229 3300053139 Bacteria 48135
148 Ga0500603_007820 3300053150 Bacteria 2354
149 Ga0500616_0000285 3300053153 Bacteria 74186
150 Ga0500636_0029120 3300053177 Bacteria 3261
151 Ga0500637_0008338 3300053178 Bacteria 5219
152 Ga0501084_0000731 3300054114 Bacteria 25045
153 Ga0501082_0004430 3300060353 Bacteria 12262
154 Ga0530510_0000249 3300061734 Bacteria 33709
155 2509148460 2508501128 Bacteria 8613869
156 2513642450 2513237094 Bacteria 8789602
157 2595452168 2593339239 Bacteria 4124669
158 2821448872 2821443989 Bacteria 7658172
159 2874170046 2874168670 Bacteria 8062617
160 2906631827 2906626472 Bacteria 8826946
161 2935870076 2935864058 Bacteria 9784707
162 2958065404 2958064165 Bacteria 7158582
163 Ga0501033_0046269
164 rootH1_10078376
165 Ga0065707_10093933
166 Ga0068869_100002667
167 Ga0070709_10023361
168 Ga0070714_100091937
169 Ga0070713_100053920
170 Ga0070713_100070290
171 Ga0070710_10051971
172 Ga0070710_10059865
173 Ga0070711_100046486
174 Ga0070708_100007598
175 Ga0070681_10033312
176 Ga0070706_100165696
177 Ga0070707_100002829
178 Ga0070707_100175550
179 Ga0070698_100009076
180 Ga0070698_100025116
181 Ga0070698_100041638
182 Ga0070698_100044635
183 Ga0070698_100132832
184 Ga0070699_100035784
185 Ga0070697_100033080
186 Ga0068856_100052167
187 Ga0068860_100018201
188 Ga0068862_100047816
189 Ga0081540_1000981
190 Ga0081540_1001720
191 Ga0081540_1012314
192 Ga0081540_1015009
193 Ga0081540_1023902
194 Ga0070717_10057869
195 Ga0075365_10104196
196 Ga0070712_100030936
197 Ga0070712_100030946
198 Ga0070712_100058623
199 Ga0075367_10021600
200 Ga0075369_10019422
201 Ga0075366_10003702
202 Ga0075370_10009247
203 Ga0075434_100185657
204 Ga0099794_10009726
205 Ga0099795_10003552
206 Ga0105251_10003705
207 Ga0105240_10015686
208 Ga0099796_10004513
209 Ga0099796_10013210
210 Ga0105239_10032891
211 Ga0213872_10001469
212 Ga0213875_10013310
213 Ga0209257_1027754
214 Ga0207713_1027378
215 Ga0207692_10006530
216 Ga0207684_10166632
217 Ga0207707_10053367
218 Ga0207695_10050906
219 Ga0207695_10053758
220 Ga0207693_10027867
221 Ga0207693_10088583
222 Ga0207646_10031097
223 Ga0207646_10081595
224 Ga0207700_10128733
225 Ga0207665_10002809
226 Ga0207689_10003670
227 Ga0207668_10025970
228 Ga0207675_100008242
229 Ga0268265_10036070
230 Ga0268264_10038448
231 Ga0265338_10002615
232 Ga0307511_10000421
233 Ga0265328_10002341
234 Ga0265316_10037381
235 Ga0307509_10000113
236 Ga0307509_10009580
237 Ga0373929_0011866
238 Ga0373927_0002120
239 Ga0373933_0015815
240 Ga0373937_0038840
241 Ga0373925_0031028
242 Ga0436364_0694743
243 Ga0436365_0389695
244 Ga0436365_0665546
245 Ga0436365_0689750
246 Ga0436365_0832333
247 Ga0436361_0087449
248 Ga0436361_0325755
249 Ga0436361_0386610
250 Ga0436361_0915035
251 Ga0436363_0846232
252 Ga0436363_1303735
253 Ga0451576_0061796
254 Ga0495629_0000004
255 Ga0495638_0056227
256 Ga0495610_0007055
257 Ga0495620_0016850
258 Ga0495648_0003277
259 Ga0495640_0064793
260 Ga0495668_0038182
261 Ga0495635_0005380
262 Ga0495669_0044967
263 Ga0495600_0039766
264 Ga0495581_0011162
265 Ga0495672_0007245
266 Ga0495680_0000761
267 Ga0495680_0085497
268 Ga0495684_0067726
269 Ga0495593_0010150
270 Ga0496101_0023478
271 Ga0496102_0090148
272 Ga0496106_0049932
273 Ga0496110_0072105
274 Ga0496117_0000663
275 Ga0496118_0002560
276 Ga0496126_0000651
277 Ga0496126_0077426
278 Ga0501036_0008774
279 Ga0501038_0028064
280 Ga0501039_0013208
281 Ga0501040_0032656
282 Ga0501041_0000846
283 Ga0501042_0053463
284 Ga0501046_0001883
285 Ga0501068_0024621
286 Ga0501071_0009791
287 Ga0501072_0074909
288 Ga0501074_0106593
289 Ga0501075_0001350
290 Ga0501076_0001809
291 Ga0501077_0020292
292 Ga0501079_0001760
293 Ga0501080_0098156
294 Ga0501081_0011510
295 Ga0501045_0001673
296 nmdc:mga05p37_17906_c1
297 nmdc:mga0n895_202118_c1
298 nmdc:mga0n895_31226_c1
299 nmdc:mga08x19_37289_c1
300 nmdc:mga0sz30_11452_c1
301 Ga0495619_0046711
302 Ga0500566_0027820
303 Ga0500640_000204
304 Ga0500554_000004
305 Ga0500595_000600
306 Ga0500614_000029
307 Ga0500559_0025811
308 Ga0500564_025943
309 Ga0500568_0000229
310 Ga0500603_007820
311 Ga0500616_0000285
312 Ga0500636_0029120
313 Ga0500637_0008338
314 Ga0501084_0000731
315 Ga0501082_0004430
316 Ga0530510_0000249
317 2509148460
318 2513642450
319 2595452168
320 2821448872
321 2874170046
322 2906631827
323 2935870076
324 2958065404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03949

Malic_M

Malic enzyme, NAD binding domain

264

513

0.98

PF00390

malic

Malic enzyme, N-terminal domain

74

254

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c7n-assembly1.cif.gz_B monoclinic form of malic enzyme from sorghum at 2 angstroms resolution 0.9766 1 541
2aw5-assembly1.cif.gz_A crystal structure of a human malic enzyme 0.9755 7 538
6c7n-assembly1.cif.gz_B monoclinic form of malic enzyme from sorghum at 2 angstroms resolution 0.9748 1 541
2aw5-assembly2.cif.gz_C crystal structure of a human malic enzyme 0.974 7 541
7x11-assembly1.cif.gz_D crystal structure of me1 in complex with nadph 0.9724 1 538
ID Description Score Start End Superfamily
af_P23368_278_584_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9808 259 531 3.40.50.720
af_Q9U296_306_603_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9788 259 534 3.40.50.720
af_Q9VG31_471_763_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9773 259 534 3.40.50.720
1llqA04 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9717 259 443 3.40.50.720
af_A1ZAF6_291_585_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9705 259 534 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A348PGT5-F1-model_v4 NAD-dependent malic enzyme 0.9886 196 536 GO:0004473
GO:0006090
GO:0006108
GO:0046872
GO:0051287
AF-A0A3D0QGK2-F1-model_v4 NAD-dependent malic enzyme (EC 1.1.1.38) 0.9861 5 95 GO:0004471
GO:0006090
GO:0006108
GO:0008948
AF-A0A1F9NKG4-F1-model_v4 NAD-dependent malic enzyme 0.9849 104 536 GO:0004473
GO:0006090
GO:0006108
GO:0046872
GO:0051287
AF-A0A817JWM7-F1-model_v4 Malic enzyme 0.9833 168 534 GO:0004473
GO:0005739
GO:0006090
GO:0006108
GO:0046872
GO:0051287
AF-A0A401TXF5-F1-model_v4 Malic enzyme 0.9828 159 304 GO:0004470
GO:0005829
GO:0006090
GO:0006108
GO:0016616
GO:0046872
GO:0051287

Map