F239134

General Info

Members Datasets Scaffolds Average Seq Length
162 118 158 450

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10166131|Ga0111539_101661312
Length 487
Sequence VLHRPSRAASRPAQMPPPRRSDETQLRSSGTLAEQQVSMTKRLFIKTYGCQMNVYDSARMAELMAPLGYAQAERPDGADLVILNTCHIREKAAEKVFSELGTIRRLKEAKRKHGGRMVVAVAGCVAQAEGAEILERAPFVDLVFGPQSYHRLPEMVARAADGSREGILDTSFPAEPKFDFLPLTTAAPGVSAFLTVQEGCDKFCTFCVVPYTRGAEYSRPATDVLAEAERLAAAGARELTLLGQNVNAYHGAAPDGGEWRLGELIGALAKTPGLERLRYTTSHPRDVDDGLIAAHRDVPQLMPFLHLPVQSGSDRVLAAMKRRHTADHYRRTVDRLRAARTDLALSSDFIVGYPGETDADFAATLDLVREIGFAQAFSFKYSPRPGTPAASAADQVPESVKSERLATLQHLLQRQQRDFSRACVGQVLPVLFEKPGRHAGQLVGRSPYLQSVHIEGGPYRIGDIVPVLIERAEPNSLAGTAAPEHRT

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
3 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
118 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.53
Metatranscriptomes 0
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0
Rhizoplane 1.23
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10102715 3300005327 Bacteria 2364
2 Ga0070676_10005828 3300005328 Bacteria 6571
3 Ga0070668_100005886 3300005347 Bacteria 9091
4 Ga0070659_100051224 3300005366 Bacteria 3246
5 Ga0070667_100245792 3300005367 Bacteria 1599
6 Ga0070714_100158215 3300005435 Bacteria 2047
7 Ga0070713_100004150 3300005436 Bacteria 9661
8 Ga0070713_100027648 3300005436 Bacteria 4467
9 Ga0070713_100063525 3300005436 Bacteria 3096
10 Ga0070713_100148793 3300005436 Bacteria 2081
11 Ga0070713_100169085 3300005436 Bacteria 1957
12 Ga0070710_10002330 3300005437 Bacteria 8990
13 Ga0070711_100011301 3300005439 Bacteria 5540
14 Ga0070711_100011753 3300005439 Bacteria 5444
15 Ga0070678_100056968 3300005456 Bacteria 2861
16 Ga0070681_10000614 3300005458 Bacteria 29218
17 Ga0070681_10043588 3300005458 Bacteria 4493
18 Ga0070706_100037492 3300005467 Bacteria 4477
19 Ga0070698_100006435 3300005471 Bacteria 12736
20 Ga0070698_100182799 3300005471 Bacteria 2035
21 Ga0070679_100000410 3300005530 Bacteria 36467
22 Ga0070684_100042146 3300005535 Bacteria 3940
23 Ga0070665_100024861 3300005548 Bacteria 6035
24 Ga0070704_100010003 3300005549 Bacteria 5761
25 Ga0068856_100015466 3300005614 Bacteria 7373
26 Ga0068860_100001901 3300005843 Bacteria 22162
27 Ga0070717_10007628 3300006028 Bacteria 8041
28 Ga0070712_100004127 3300006175 Bacteria 8927
29 Ga0068871_100206475 3300006358 Bacteria 1698
30 Ga0075428_100224545 3300006844 Bacteria 2028
31 Ga0075436_100014009 3300006914 Bacteria 5487
32 Ga0075435_100030327 3300007076 Bacteria 4250
33 Ga0099795_10000291 3300007788 Bacteria 8993
34 Ga0099795_10001848 3300007788 Bacteria 4780
35 Ga0099795_10007906 3300007788 Bacteria 3000
36 Ga0105240_10064934 3300009093 Bacteria 4533
37 Ga0105240_10079056 3300009093 Bacteria 4049
38 Ga0111539_10166131 3300009094 Bacteria 2580
39 Ga0105245_10167704 3300009098 Bacteria 2088
40 Ga0105243_10018988 3300009148 Bacteria 5212
41 Ga0105242_10007600 3300009176 Bacteria 8341
42 Ga0099796_10000321 3300010159 Bacteria 7697
43 Ga0157370_10000971 3300013104 Bacteria 36295
44 Ga0157370_10004453 3300013104 Bacteria 16057
45 Ga0157372_10001838 3300013307 Bacteria 23006
46 Ga0157372_10024997 3300013307 Bacteria 6490
47 Ga0157372_10190503 3300013307 Bacteria 2376
48 Ga0157377_10044253 3300014745 Bacteria 2481
49 Ga0157379_10001360 3300014968 Bacteria 20024
50 Ga0213874_10000767 3300021377 Bacteria 6522
51 Ga0213875_10000081 3300021388 Bacteria 114181
52 Ga0213875_10008671 3300021388 Bacteria 5191
53 Ga0213875_10035689 3300021388 Bacteria 2346
54 Ga0209563_101834 3300025230 Bacteria 5229
55 Ga0209676_1000197 3300025292 Bacteria 135043
56 Ga0209050_1018758 3300025298 Bacteria 2667
57 Ga0207645_10011026 3300025907 Bacteria 6185
58 Ga0207705_10084586 3300025909 Bacteria 2316
59 Ga0207684_10075857 3300025910 Bacteria 2857
60 Ga0207684_10087450 3300025910 Bacteria 2655
61 Ga0207707_10001175 3300025912 Bacteria 24645
62 Ga0207707_10092699 3300025912 Bacteria 2639
63 Ga0207693_10001699 3300025915 Bacteria 19392
64 Ga0207693_10061204 3300025915 Bacteria 2948
65 Ga0207693_10067523 3300025915 Bacteria 2800
66 Ga0207663_10008022 3300025916 Bacteria 5505
67 Ga0207663_10045728 3300025916 Bacteria 2694
68 Ga0207663_10129099 3300025916 Bacteria 1743
69 Ga0207652_10002885 3300025921 Bacteria 14366
70 Ga0207646_10008878 3300025922 Bacteria 10011
71 Ga0207694_10035169 3300025924 Bacteria 3842
72 Ga0207659_10024725 3300025926 Bacteria 4029
73 Ga0207700_10077507 3300025928 Bacteria 2582
74 Ga0207700_10207452 3300025928 Bacteria 1655
75 Ga0207664_10022549 3300025929 Bacteria 4704
76 Ga0207664_10056646 3300025929 Bacteria 3113
77 Ga0207664_10124397 3300025929 Bacteria 2163
78 Ga0207690_10030336 3300025932 Bacteria 3448
79 Ga0207709_10010059 3300025935 Bacteria 5212
80 Ga0207669_10079482 3300025937 Bacteria 2094
81 Ga0207689_10059782 3300025942 Bacteria 3134
82 Ga0207668_10120003 3300025972 Bacteria 1989
83 Ga0207702_10030791 3300026078 Bacteria 4470
84 Ga0207702_10060539 3300026078 Bacteria 3228
85 Ga0207648_10059609 3300026089 Bacteria 3329
86 Ga0207674_10229199 3300026116 Bacteria 1805
87 Ga0207683_10007425 3300026121 Bacteria 9401
88 Ga0268265_10002265 3300028380 Bacteria 14691
89 Ga0268264_10000014 3300028381 Bacteria 509962
90 Ga0265334_10001120 3300028573 Bacteria 13092
91 Ga0265338_10020399 3300028800 Bacteria 6972
92 Ga0265338_10032674 3300028800 Bacteria 5067
93 Ga0265332_10004408 3300031238 Bacteria 6613
94 Ga0265316_10027636 3300031344 Bacteria 4693
95 Ga0265342_10017200 3300031712 Bacteria 4709
96 Ga0265342_10041096 3300031712 Bacteria 2802
97 Ga0307415_100120594 3300032126 Bacteria 1966
98 Ga0373943_0022128 3300035170 Bacteria 2942
99 Ga0373955_0057504 3300035172 Bacteria 2137
100 Ga0373935_0084348 3300035692 Bacteria 2069
101 Ga0373927_0093649 3300035695 Bacteria 1952
102 Ga0373937_0004571 3300036401 Bacteria 11741
103 Ga0373937_0022511 3300036401 Bacteria 5667
104 Ga0373925_0024569 3300037068 Bacteria 4399
105 Ga0395899_0000018 3300037312 Bacteria 423194
106 Ga0436364_0560002 3300037853 Bacteria 93566
107 Ga0436364_0590691 3300037853 Bacteria 7763
108 Ga0436364_0892425 3300037853 Bacteria 2567
109 Ga0395901_0061822 3300038443 Bacteria 3897
110 Ga0436365_1126886 3300039437 Bacteria 1752
111 Ga0436361_0049627 3300039447 Bacteria 2178
112 Ga0436361_0723056 3300039447 Bacteria 7631
113 Ga0436361_1110848 3300039447 Bacteria 8250
114 Ga0436363_1295373 3300039450 Bacteria 3056
115 Ga0436362_0946946 3300039453 Bacteria 3095
116 Ga0451576_0007428 3300045051 Bacteria 13106
117 Ga0451576_0137140 3300045051 Bacteria 2552
118 Ga0466967_0048127 3300045976 Bacteria 3722
119 Ga0495600_0009129 3300046809 Bacteria 6116
120 Ga0496111_0086995 3300048914 Bacteria 2287
121 Ga0496112_0090133 3300048915 Bacteria 3035
122 Ga0501031_0118015 3300049568 Bacteria 1733
123 Ga0501032_0009884 3300049569 Bacteria 6894
124 Ga0501033_0000120 3300049570 Bacteria 75504
125 Ga0501033_0112711 3300049570 Bacteria 1978
126 Ga0501033_0150346 3300049570 Bacteria 1680
127 Ga0501034_0109880 3300049571 Bacteria 2748
128 Ga0501034_0135811 3300049571 Bacteria 2440
129 Ga0501036_0016221 3300049572 Bacteria 6221
130 Ga0501036_0163732 3300049572 Bacteria 1875
131 Ga0501039_0002701 3300049575 Bacteria 13242
132 Ga0501042_0064899 3300049578 Bacteria 2609
133 Ga0501046_0007227 3300049580 Bacteria 9762
134 Ga0501047_0048786 3300049581 Bacteria 4088
135 Ga0501047_0055311 3300049581 Bacteria 3838
136 Ga0501047_0146661 3300049581 Bacteria 2236
137 Ga0501048_0023850 3300049582 Bacteria 4468
138 Ga0501067_0011399 3300049583 Bacteria 4921
139 Ga0501068_0046213 3300049584 Bacteria 2625
140 Ga0501069_0050513 3300049585 Bacteria 2312
141 Ga0501070_0009406 3300049586 Bacteria 8261
142 Ga0501070_0163548 3300049586 Bacteria 1834
143 Ga0501073_0135158 3300049589 Bacteria 1709
144 Ga0501074_0021802 3300049590 Bacteria 4650
145 Ga0501079_0047098 3300049741 Bacteria 3326
146 Ga0501080_0029439 3300049742 Bacteria 5112
147 Ga0501035_0000954 3300049822 Bacteria 30597
148 Ga0501035_0267360 3300049822 Bacteria 1448
149 Ga0501044_0035918 3300049823 Bacteria 5186
150 Ga0501044_0141171 3300049823 Bacteria 2397
151 Ga0501045_0036948 3300049824 Bacteria 3549
152 nmdc:mga08y16_25558_c1 3300050511 Bacteria 6229
153 nmdc:mga08x19_54881_c1 3300050514 Bacteria 2566
154 Ga0495601_0028104 3300053077 Bacteria 3481
155 Ga0501084_0000140 3300054114 Bacteria 54374
156 Ga0501084_0001323 3300054114 Bacteria 19524
157 Ga0501084_0104575 3300054114 Bacteria 2378
158 Ga0501082_0057144 3300060353 Bacteria 3362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035170 Ga0373943_0022128 Ga0373943_0022128_23_1168 359
2 3300048914 Ga0496111_0086995 Ga0496111_0086995_12_1274 366
3 3300049822 Ga0501035_0267360 Ga0501035_0267360_232_1422 396
4 3300032126 Ga0307415_100120594 Ga0307415_1001205942 404
5 3300005549 Ga0070704_100010003 Ga0070704_1000100033 405
6 3300054114 Ga0501084_0104575 Ga0501084_0104575_20_1327 416
7 3300039453 Ga0436362_0946946 Ga0436362_0946946_560_1978 417
8 3300039437 Ga0436365_1126886 Ga0436365_1126886_26_1429 418
9 3300005347 Ga0070668_100005886 Ga0070668_1000058868 423
10 3300005367 Ga0070667_100245792 Ga0070667_1002457921 423
11 3300025972 Ga0207668_10120003 Ga0207668_101200032 423
12 3300028380 Ga0268265_10002265 Ga0268265_100022659 423
13 3300021388 Ga0213875_10008671 Ga0213875_100086713 424
14 3300037853 Ga0436364_0590691 Ga0436364_0590691_6359_7690 424
15 3300038443 Ga0395901_0061822 Ga0395901_0061822_1911_3239 424
16 3300049572 Ga0501036_0163732 Ga0501036_0163732_570_1844 424
17 3300049823 Ga0501044_0141171 Ga0501044_0141171_12_1286 424
18 3300021388 Ga0213875_10035689 Ga0213875_100356892 425
19 3300037853 Ga0436364_0892425 Ga0436364_0892425_518_1876 425
20 3300006914 Ga0075436_100014009 Ga0075436_1000140092 426
21 3300035172 Ga0373955_0057504 Ga0373955_0057504_366_1748 426
22 3300035695 Ga0373927_0093649 Ga0373927_0093649_44_1399 426
23 3300046809 Ga0495600_0009129 Ga0495600_0009129_636_2018 426
24 3300050514 nmdc:mga08x19_54881_c1 nmdc:mga08x19_54881_c1_12_1514 426
25 3300053077 Ga0495601_0028104 Ga0495601_0028104_176_1558 426
26 3300005843 Ga0068860_100001901 Ga0068860_10000190112 433
27 3300025292 Ga0209676_1000197 Ga0209676_100019776 433
28 3300025298 Ga0209050_1018758 Ga0209050_10187582 433
29 3300028381 Ga0268264_10000014 Ga0268264_10000014290 433
30 3300036401 Ga0373937_0022511 Ga0373937_0022511_704_2047 433
31 iso_pu_bacteria 2511231221 2512034821 433
32 iso_pu_bacteria 2522572158 2523103442 433
33 iso_pu_bacteria 2848858292 2848861207 433
34 iso_pu_bacteria 8054002106 8054003739 433
35 3300028800 Ga0265338_10032674 Ga0265338_100326745 434
36 3300039447 Ga0436361_1110848 Ga0436361_1110848_5291_6688 434
37 3300045051 Ga0451576_0007428 Ga0451576_0007428_5168_6658 434
38 3300009093 Ga0105240_10064934 Ga0105240_100649341 435
39 3300025230 Ga0209563_101834 Ga0209563_1018342 435
40 3300049570 Ga0501033_0000120 Ga0501033_0000120_54664_56109 435
41 3300049822 Ga0501035_0000954 Ga0501035_0000954_572_2017 435
42 3300005327 Ga0070658_10102715 Ga0070658_101027152 436
43 3300005328 Ga0070676_10005828 Ga0070676_100058282 436
44 3300005366 Ga0070659_100051224 Ga0070659_1000512242 436
45 3300005435 Ga0070714_100158215 Ga0070714_1001582152 436
46 3300005436 Ga0070713_100004150 Ga0070713_1000041502 436
47 3300005436 Ga0070713_100027648 Ga0070713_1000276484 436
48 3300005436 Ga0070713_100063525 Ga0070713_1000635252 436
49 3300005436 Ga0070713_100148793 Ga0070713_1001487932 436
50 3300005436 Ga0070713_100169085 Ga0070713_1001690852 436
51 3300005437 Ga0070710_10002330 Ga0070710_100023305 436
52 3300005439 Ga0070711_100011301 Ga0070711_1000113015 436
53 3300005439 Ga0070711_100011753 Ga0070711_1000117534 436
54 3300005456 Ga0070678_100056968 Ga0070678_1000569682 436
55 3300005458 Ga0070681_10000614 Ga0070681_100006149 436
56 3300005458 Ga0070681_10043588 Ga0070681_100435884 436
57 3300005467 Ga0070706_100037492 Ga0070706_1000374924 436
58 3300005471 Ga0070698_100006435 Ga0070698_10000643512 436
59 3300005471 Ga0070698_100182799 Ga0070698_1001827992 436
60 3300005530 Ga0070679_100000410 Ga0070679_10000041027 436
61 3300005535 Ga0070684_100042146 Ga0070684_1000421462 436
62 3300005548 Ga0070665_100024861 Ga0070665_1000248613 436
63 3300005614 Ga0068856_100015466 Ga0068856_1000154664 436
64 3300006028 Ga0070717_10007628 Ga0070717_100076281 436
65 3300006175 Ga0070712_100004127 Ga0070712_10000412710 436
66 3300006358 Ga0068871_100206475 Ga0068871_1002064752 436
67 3300006844 Ga0075428_100224545 Ga0075428_1002245452 436
68 3300007076 Ga0075435_100030327 Ga0075435_1000303271 436
69 3300007788 Ga0099795_10000291 Ga0099795_100002912 436
70 3300007788 Ga0099795_10001848 Ga0099795_100018482 436
71 3300007788 Ga0099795_10007906 Ga0099795_100079063 436
72 3300009093 Ga0105240_10079056 Ga0105240_100790562 436
73 3300009094 Ga0111539_10166131 Ga0111539_101661312 436
74 3300009098 Ga0105245_10167704 Ga0105245_101677042 436
75 3300009148 Ga0105243_10018988 Ga0105243_100189886 436
76 3300009176 Ga0105242_10007600 Ga0105242_100076005 436
77 3300010159 Ga0099796_10000321 Ga0099796_100003215 436
78 3300013104 Ga0157370_10000971 Ga0157370_1000097115 436
79 3300013104 Ga0157370_10004453 Ga0157370_100044534 436
80 3300013307 Ga0157372_10001838 Ga0157372_1000183816 436
81 3300013307 Ga0157372_10024997 Ga0157372_100249974 436
82 3300013307 Ga0157372_10190503 Ga0157372_101905032 436
83 3300014745 Ga0157377_10044253 Ga0157377_100442532 436
84 3300014968 Ga0157379_10001360 Ga0157379_1000136016 436
85 3300021377 Ga0213874_10000767 Ga0213874_100007674 436
86 3300021388 Ga0213875_10000081 Ga0213875_1000008172 436
87 3300025907 Ga0207645_10011026 Ga0207645_100110267 436
88 3300025909 Ga0207705_10084586 Ga0207705_100845862 436
89 3300025910 Ga0207684_10075857 Ga0207684_100758572 436
90 3300025910 Ga0207684_10087450 Ga0207684_100874502 436
91 3300025912 Ga0207707_10001175 Ga0207707_1000117519 436
92 3300025912 Ga0207707_10092699 Ga0207707_100926992 436
93 3300025915 Ga0207693_10001699 Ga0207693_1000169920 436
94 3300025915 Ga0207693_10061204 Ga0207693_100612042 436
95 3300025915 Ga0207693_10067523 Ga0207693_100675233 436
96 3300025916 Ga0207663_10008022 Ga0207663_100080222 436
97 3300025916 Ga0207663_10045728 Ga0207663_100457282 436
98 3300025916 Ga0207663_10129099 Ga0207663_101290991 436
99 3300025921 Ga0207652_10002885 Ga0207652_100028855 436
100 3300025922 Ga0207646_10008878 Ga0207646_100088784 436
101 3300025924 Ga0207694_10035169 Ga0207694_100351694 436
102 3300025926 Ga0207659_10024725 Ga0207659_100247254 436
103 3300025928 Ga0207700_10077507 Ga0207700_100775072 436
104 3300025928 Ga0207700_10207452 Ga0207700_102074521 436
105 3300025929 Ga0207664_10022549 Ga0207664_100225494 436
106 3300025929 Ga0207664_10056646 Ga0207664_100566462 436
107 3300025929 Ga0207664_10124397 Ga0207664_101243972 436
108 3300025932 Ga0207690_10030336 Ga0207690_100303363 436
109 3300025935 Ga0207709_10010059 Ga0207709_100100596 436
110 3300025937 Ga0207669_10079482 Ga0207669_100794822 436
111 3300025942 Ga0207689_10059782 Ga0207689_100597821 436
112 3300026078 Ga0207702_10030791 Ga0207702_100307911 436
113 3300026078 Ga0207702_10060539 Ga0207702_100605394 436
114 3300026089 Ga0207648_10059609 Ga0207648_100596093 436
115 3300026116 Ga0207674_10229199 Ga0207674_102291991 436
116 3300026121 Ga0207683_10007425 Ga0207683_100074256 436
117 3300028573 Ga0265334_10001120 Ga0265334_100011207 436
118 3300028800 Ga0265338_10020399 Ga0265338_100203994 436
119 3300031238 Ga0265332_10004408 Ga0265332_100044087 436
120 3300031344 Ga0265316_10027636 Ga0265316_100276365 436
121 3300031712 Ga0265342_10017200 Ga0265342_100172004 436
122 3300031712 Ga0265342_10041096 Ga0265342_100410962 436
123 3300035692 Ga0373935_0084348 Ga0373935_0084348_466_1845 436
124 3300036401 Ga0373937_0004571 Ga0373937_0004571_7377_8729 436
125 3300037068 Ga0373925_0024569 Ga0373925_0024569_963_2342 436
126 3300037312 Ga0395899_0000018 Ga0395899_0000018_376260_377660 436
127 3300037853 Ga0436364_0560002 Ga0436364_0560002_44553_46016 436
128 3300039447 Ga0436361_0049627 Ga0436361_0049627_47_1429 436
129 3300039447 Ga0436361_0723056 Ga0436361_0723056_1590_2999 436
130 3300039450 Ga0436363_1295373 Ga0436363_1295373_1645_3003 436
131 3300045051 Ga0451576_0137140 Ga0451576_0137140_72_1463 436
132 3300045976 Ga0466967_0048127 Ga0466967_0048127_1875_3227 436
133 3300048915 Ga0496112_0090133 Ga0496112_0090133_197_1576 436
134 3300049568 Ga0501031_0118015 Ga0501031_0118015_20_1330 436
135 3300049569 Ga0501032_0009884 Ga0501032_0009884_647_1957 436
136 3300049570 Ga0501033_0112711 Ga0501033_0112711_16_1386 436
137 3300049570 Ga0501033_0150346 Ga0501033_0150346_50_1387 436
138 3300049571 Ga0501034_0109880 Ga0501034_0109880_352_1722 436
139 3300049571 Ga0501034_0135811 Ga0501034_0135811_944_2254 436
140 3300049572 Ga0501036_0016221 Ga0501036_0016221_4070_5380 436
141 3300049575 Ga0501039_0002701 Ga0501039_0002701_5540_6850 436
142 3300049578 Ga0501042_0064899 Ga0501042_0064899_798_2108 436
143 3300049580 Ga0501046_0007227 Ga0501046_0007227_7735_9045 436
144 3300049581 Ga0501047_0048786 Ga0501047_0048786_2108_3418 436
145 3300049581 Ga0501047_0055311 Ga0501047_0055311_275_1648 436
146 3300049581 Ga0501047_0146661 Ga0501047_0146661_191_1561 436
147 3300049582 Ga0501048_0023850 Ga0501048_0023850_1944_3254 436
148 3300049583 Ga0501067_0011399 Ga0501067_0011399_2397_3707 436
149 3300049584 Ga0501068_0046213 Ga0501068_0046213_411_1721 436
150 3300049585 Ga0501069_0050513 Ga0501069_0050513_969_2279 436
151 3300049586 Ga0501070_0009406 Ga0501070_0009406_1255_2565 436
152 3300049586 Ga0501070_0163548 Ga0501070_0163548_337_1707 436
153 3300049589 Ga0501073_0135158 Ga0501073_0135158_95_1405 436
154 3300049590 Ga0501074_0021802 Ga0501074_0021802_2254_3564 436
155 3300049741 Ga0501079_0047098 Ga0501079_0047098_732_2042 436
156 3300049742 Ga0501080_0029439 Ga0501080_0029439_2833_4143 436
157 3300049823 Ga0501044_0035918 Ga0501044_0035918_3286_4596 436
158 3300049824 Ga0501045_0036948 Ga0501045_0036948_531_1841 436
159 3300050511 nmdc:mga08y16_25558_c1 nmdc:mga08y16_25558_c1_4321_5688 436
160 3300054114 Ga0501084_0000140 Ga0501084_0000140_15843_17159 436
161 3300054114 Ga0501084_0001323 Ga0501084_0001323_12081_13391 436
162 3300060353 Ga0501082_0057144 Ga0501082_0057144_734_2101 436

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01938

TRAM

TRAM domain

421

482

0.95

PF04055

Radical_SAM

Radical SAM superfamily

194

368

0.95

PF00919

UPF0004

Uncharacterized protein family UPF0004

42

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9216 2 436
7mjx-assembly1.cif.gz_A miab in the complex with 5'-deoxyadenosine, methionine and rna 0.9175 2 436
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9168 147 436
2qgq-assembly1.cif.gz_A crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9137 148 436
2qgq-assembly4.cif.gz_D crystal structure of tm_1862 from thermotoga maritima. northeast structural genomics consortium target vr77 0.9135 147 436
ID Description Score Start End Superfamily
af_P0AEI1_145_378_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9703 147 374 3.80.30.20
4jc0B03 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9694 260 376 3.30.750.200
af_F1LV76_14_128_3.30.750.200 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.9664 259 368 3.30.750.200
af_P0AEI1_3_129_3.40.50.12160 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Methylthiotransferase, N-terminal domain 0.9652 2 131 3.40.50.12160
af_Q2FXZ6_140_373_3.80.30.20 Alpha Beta;Alpha-Beta Horseshoe;pyruvate-formate lyase- activating enzyme;tm_1862 like domain 0.9615 149 376 3.80.30.20
ID Description Score Start End GO Terms
AF-A0A3B9YSS9-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9953 359 436 GO:0016740
AF-A0A4Q3K8N4-F1-model_v4 deleted 0.9902 1 114
AF-A0A6G3WU15-F1-model_v4 Radical SAM protein 0.9841 260 380 GO:0005829
GO:0035597
GO:0051539
AF-A0A3B9TUY4-F1-model_v4 tRNA (N6-isopentenyl adenosine(37)-C2)-methylthiotransferase MiaB 0.9824 1 119 GO:0005829
GO:0035597
GO:0046872
GO:0051539
AF-A0A435LFX3-F1-model_v4 deleted 0.9818 2 91

Feature Viewer

pLDDT pTM Quality
90.33 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map