F239076

General Info

Members Datasets Scaffolds Average Seq Length
162 115 324 382

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100103687|Ga0075435_1001036872
Length 417
Sequence MSYFRHWNEARNPHQRSLASDTLIARVSCRHVKNTAEVVIIGGGCMGASTAYYLARNGVRDVVLLEREPMLGMGSTGRNAGGVRHQFSSEANVKLSIESIRLFERFAEEVGYEIDFHQDGYLFLLSTEKDLSDFQRNVEMQRRLGVEVEVLTPNEARTLAPGLEVGGVIGATFCARDGIADPNGVTMGFAKAAQAAGVEICRETAVTGIRTEAARXXXXETTRGTISVPTVVNAAGPYARDIGKMVGLKVPVFPYRRHIFITETLTPVSSVPGSKIMVIDFETTFYFHREGAGILFGMSDPDEPSSYNLTVSWEFLEKLTRTALKRLPALAEAGIAHAWAGLYEMTPDAMPIIGAAPQVEGLFIVAGFSGHGFQHSPAAGRALAEIIVNGDARNLDMTPFSFDRFSRGAHESEANVV

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
78 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
79 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
80 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
81 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
82 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
83 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
84 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
93 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
105 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
112 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
114 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.47
Rhizosphere 97.53
Stem 0
Stem Tuber 0
Unclassified 18.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100103687 3300007076 Bacteria 2359
2 Ga0065712_10075109 3300005290 Bacteria 3933
3 Ga0070666_10017979 3300005335 Bacteria 4538
4 Ga0068868_100064757 3300005338 Bacteria 2903
5 Ga0068868_100189236 3300005338 Unclassified 1711
6 Ga0070660_100001540 3300005339 Bacteria 15835
7 Ga0070689_100207903 3300005340 Bacteria 1601
8 Ga0070687_100011722 3300005343 Bacteria 3846
9 Ga0070687_100181464 3300005343 Unclassified 1261
10 Ga0070688_100003919 3300005365 Bacteria 7717
11 Ga0070703_10000295 3300005406 Bacteria 23006
12 Ga0070709_10000095 3300005434 Bacteria 62335
13 Ga0070714_100008675 3300005435 Bacteria 7947
14 Ga0070711_100000061 3300005439 Bacteria 64645
15 Ga0070705_100000123 3300005440 Bacteria 44901
16 Ga0070708_100126810 3300005445 Unclassified 2360
17 Ga0070681_10066668 3300005458 Bacteria 3569
18 Ga0070685_10174118 3300005466 Unclassified 1381
19 Ga0070706_100002057 3300005467 Bacteria 20610
20 Ga0070707_100060909 3300005468 Unclassified 3620
21 Ga0070698_100023252 3300005471 Bacteria 6480
22 Ga0070698_100101858 3300005471 Bacteria 2843
23 Ga0070699_100000045 3300005518 Bacteria 125943
24 Ga0070699_100000480 3300005518 Bacteria 38016
25 Ga0070679_100173838 3300005530 Bacteria 2126
26 Ga0070697_100259461 3300005536 Bacteria 1488
27 Ga0068853_100193263 3300005539 Bacteria 1850
28 Ga0070686_100000339 3300005544 Bacteria 30235
29 Ga0070695_100079926 3300005545 Bacteria 2160
30 Ga0070696_100000645 3300005546 Bacteria 22313
31 Ga0070696_100158059 3300005546 Unclassified 1668
32 Ga0070693_100017047 3300005547 Unclassified 3769
33 Ga0070665_100079593 3300005548 Bacteria 3283
34 Ga0068855_100025664 3300005563 Bacteria 7048
35 Ga0068854_100229448 3300005578 Bacteria 1473
36 Ga0068864_100149110 3300005618 Bacteria 2117
37 Ga0070716_100094345 3300006173 Unclassified 1819
38 Ga0075428_100014833 3300006844 Bacteria 8660
39 Ga0075430_100082300 3300006846 Bacteria 2697
40 Ga0075431_100129041 3300006847 Bacteria 2609
41 Ga0075433_10031237 3300006852 Bacteria 4552
42 Ga0075433_10130448 3300006852 Bacteria 2233
43 Ga0075433_10312882 3300006852 Unclassified 1390
44 Ga0075434_100117060 3300006871 Bacteria 2678
45 Ga0075434_100181172 3300006871 Bacteria 2127
46 Ga0075429_100041599 3300006880 Bacteria 4003
47 Ga0075436_100001380 3300006914 Bacteria 16523
48 Ga0075436_100003898 3300006914 Bacteria 10225
49 Ga0075436_100006962 3300006914 Bacteria 7739
50 Ga0075436_100035418 3300006914 Bacteria 3444
51 Ga0075435_100000612 3300007076 Bacteria 21924
52 Ga0075435_100003797 3300007076 Bacteria 10299
53 Ga0075435_100020880 3300007076 Bacteria 5027
54 Ga0075435_100067718 3300007076 Bacteria 2907
55 Ga0099794_10129023 3300007265 Unclassified 1276
56 Ga0105240_10160708 3300009093 Bacteria 2668
57 Ga0105240_10165893 3300009093 Bacteria 2620
58 Ga0111539_10019173 3300009094 Bacteria 8451
59 Ga0111539_10092979 3300009094 Unclassified 3543
60 Ga0111539_10420813 3300009094 Unclassified 1556
61 Ga0105245_10079531 3300009098 Bacteria 2993
62 Ga0114129_10002216 3300009147 Bacteria 26789
63 Ga0114129_10006987 3300009147 Archaea 16068
64 Ga0114129_10012320 3300009147 Bacteria 12168
65 Ga0114129_10041251 3300009147 Bacteria 6504
66 Ga0114129_10058178 3300009147 Bacteria 5407
67 Ga0114129_10154129 3300009147 Bacteria 3143
68 Ga0114129_10245469 3300009147 Unclassified 2406
69 Ga0105248_10037888 3300009177 Bacteria 5394
70 Ga0105248_10047382 3300009177 Bacteria 4819
71 Ga0157375_10109865 3300013308 Bacteria 2854
72 Ga0163163_10166821 3300014325 Bacteria 2248
73 Ga0157380_10096066 3300014326 Unclassified 2456
74 Ga0157376_10473130 3300014969 Bacteria 1226
75 Ga0207653_10000055 3300025885 Bacteria 87490
76 Ga0207680_10036707 3300025903 Unclassified 2824
77 Ga0207699_10000001 3300025906 Bacteria 695560
78 Ga0207643_10086242 3300025908 Bacteria 1824
79 Ga0207684_10000164 3300025910 Bacteria 112655
80 Ga0207663_10000005 3300025916 Bacteria 282473
81 Ga0207662_10010222 3300025918 Bacteria 5175
82 Ga0207646_10292351 3300025922 Bacteria 1472
83 Ga0207659_10248778 3300025926 Bacteria 1442
84 Ga0207706_10157863 3300025933 Bacteria 1994
85 Ga0207665_10071202 3300025939 Unclassified 2373
86 Ga0207711_10019654 3300025941 Bacteria 5623
87 Ga0207711_10023024 3300025941 Bacteria 5215
88 Ga0207661_10298402 3300025944 Unclassified 1444
89 Ga0207640_10234178 3300025981 Bacteria 1415
90 Ga0207708_10120069 3300026075 Unclassified 2048
91 Ga0207674_10094408 3300026116 Bacteria 2978
92 Ga0207428_10077620 3300027907 Bacteria 2600
93 Ga0307408_100008158 3300031548 Bacteria 6917
94 Ga0316578_10121369 3300031728 Bacteria 1571
95 Ga0307405_10031363 3300031731 Bacteria 3128
96 Ga0307413_10014194 3300031824 Bacteria 4036
97 Ga0307413_10043987 3300031824 Bacteria 2636
98 Ga0307410_10008748 3300031852 Bacteria 5634
99 Ga0307410_10024028 3300031852 Bacteria 3801
100 Ga0307412_10045593 3300031911 Bacteria 2867
101 Ga0307409_100026721 3300031995 Bacteria 4076
102 Ga0307409_100097968 3300031995 Bacteria 2423
103 Ga0307416_100026609 3300032002 Bacteria 4265
104 Ga0307414_10192784 3300032004 Unclassified 1650
105 Ga0307411_10009375 3300032005 Bacteria 5142
106 Ga0307411_10243209 3300032005 Unclassified 1410
107 Ga0307415_100150964 3300032126 Unclassified 1788
108 Ga0373950_0004285 3300034818 Bacteria 2083
109 Ga0373938_0001234 3300034957 Bacteria 4118
110 Ga0373928_0002825 3300035084 Bacteria 3345
111 Ga0373949_0001989 3300035090 Bacteria 5462
112 Ga0373932_0000581 3300035112 Bacteria 11169
113 Ga0373939_0001473 3300035114 Bacteria 5704
114 Ga0373941_0000907 3300035115 Bacteria 6101
115 Ga0373955_0129275 3300035172 Bacteria 1474
116 Ga0373961_0001350 3300035241 Bacteria 7370
117 Ga0373962_0002739 3300035242 Bacteria 4199
118 Ga0373931_0001413 3300035691 Bacteria 10280
119 Ga0439446_0036558 3300042156 Bacteria 1435
120 Ga0453684_0143331 3300044712 Bacteria 2849
121 Ga0451576_0011210 3300045051 Bacteria 10212
122 Ga0495592_0011047 3300046454 Bacteria 6815
123 Ga0495647_0054060 3300046681 Bacteria 1568
124 Ga0495647_0082361 3300046681 Bacteria 1307
125 Ga0496102_0222740 3300048905 Unclassified 1779
126 Ga0496107_0045719 3300048910 Bacteria 3150
127 Ga0496109_0043707 3300048912 Bacteria 4062
128 Ga0496112_0062272 3300048915 Bacteria 3680
129 Ga0501034_0089019 3300049571 Bacteria 3085
130 Ga0501036_0181493 3300049572 Bacteria 1772
131 Ga0501040_0028957 3300049576 Unclassified 3736
132 Ga0501048_0046123 3300049582 Bacteria 3112
133 Ga0501074_0142403 3300049590 Bacteria 1715
134 Ga0501081_0280335 3300049743 Unclassified 1220
135 nmdc:mga05p37_177416_c1 3300050507 Bacteria 2595
136 nmdc:mga05p37_198943_c1 3300050507 Unclassified 2428
137 nmdc:mga05p37_265341_c1 3300050507 Unclassified 2053
138 nmdc:mga05p37_391191_c1 3300050507 Unclassified 1626
139 nmdc:mga05p37_478_c1 3300050507 Bacteria 43664
140 nmdc:mga05p37_68057_c1 3300050507 Bacteria 4379
141 nmdc:mga05p37_71669_c1 3300050507 Bacteria 4263
142 nmdc:mga05p37_8954_c1 3300050507 Bacteria 11837
143 nmdc:mga09592_222984_c1 3300050508 Unclassified 1633
144 nmdc:mga06r32_187698_c1 3300050510 Bacteria 2054
145 nmdc:mga08y16_33042_c1 3300050511 Bacteria 5436
146 nmdc:mga08y16_61124_c1 3300050511 Bacteria 3934
147 nmdc:mga0n895_18254_c1 3300050512 Bacteria 6487
148 nmdc:mga0n895_193425_c1 3300050512 Bacteria 2065
149 nmdc:mga0n895_491370_c1 3300050512 Unclassified 1237
150 nmdc:mga0n895_81713_c1 3300050512 Bacteria 3220
151 nmdc:mga0rr50_1982_c1 3300050513 Bacteria 11379
152 nmdc:mga0rr50_210223_c1 3300050513 Unclassified 1603
153 nmdc:mga0rr50_695_c1 3300050513 Bacteria 18012
154 nmdc:mga0rr50_82080_c1 3300050513 Bacteria 2489
155 nmdc:mga08x19_20_c1 3300050514 Bacteria 304974
156 nmdc:mga0a205_8811_c1 3300050515 Bacteria 9190
157 nmdc:mga0a205_92154_c1 3300050515 Bacteria 2928
158 Ga0590071_000071 3300059421 Bacteria 27631
159 Ga0590074_000535 3300059423 Bacteria 5699
160 Ga0590075_000324 3300059424 Bacteria 13248
161 Ga0590077_000172 3300059426 Bacteria 18195
162 Ga0590077_006060 3300059426 Bacteria 2479
163 Ga0075435_100103687
164 Ga0065712_10075109
165 Ga0070666_10017979
166 Ga0068868_100064757
167 Ga0068868_100189236
168 Ga0070660_100001540
169 Ga0070689_100207903
170 Ga0070687_100011722
171 Ga0070687_100181464
172 Ga0070688_100003919
173 Ga0070703_10000295
174 Ga0070709_10000095
175 Ga0070714_100008675
176 Ga0070711_100000061
177 Ga0070705_100000123
178 Ga0070708_100126810
179 Ga0070681_10066668
180 Ga0070685_10174118
181 Ga0070706_100002057
182 Ga0070707_100060909
183 Ga0070698_100023252
184 Ga0070698_100101858
185 Ga0070699_100000045
186 Ga0070699_100000480
187 Ga0070679_100173838
188 Ga0070697_100259461
189 Ga0068853_100193263
190 Ga0070686_100000339
191 Ga0070695_100079926
192 Ga0070696_100000645
193 Ga0070696_100158059
194 Ga0070693_100017047
195 Ga0070665_100079593
196 Ga0068855_100025664
197 Ga0068854_100229448
198 Ga0068864_100149110
199 Ga0070716_100094345
200 Ga0075428_100014833
201 Ga0075430_100082300
202 Ga0075431_100129041
203 Ga0075433_10031237
204 Ga0075433_10130448
205 Ga0075433_10312882
206 Ga0075434_100117060
207 Ga0075434_100181172
208 Ga0075429_100041599
209 Ga0075436_100001380
210 Ga0075436_100003898
211 Ga0075436_100006962
212 Ga0075436_100035418
213 Ga0075435_100000612
214 Ga0075435_100003797
215 Ga0075435_100020880
216 Ga0075435_100067718
217 Ga0099794_10129023
218 Ga0105240_10160708
219 Ga0105240_10165893
220 Ga0111539_10019173
221 Ga0111539_10092979
222 Ga0111539_10420813
223 Ga0105245_10079531
224 Ga0114129_10002216
225 Ga0114129_10006987
226 Ga0114129_10012320
227 Ga0114129_10041251
228 Ga0114129_10058178
229 Ga0114129_10154129
230 Ga0114129_10245469
231 Ga0105248_10037888
232 Ga0105248_10047382
233 Ga0157375_10109865
234 Ga0163163_10166821
235 Ga0157380_10096066
236 Ga0157376_10473130
237 Ga0207653_10000055
238 Ga0207680_10036707
239 Ga0207699_10000001
240 Ga0207643_10086242
241 Ga0207684_10000164
242 Ga0207663_10000005
243 Ga0207662_10010222
244 Ga0207646_10292351
245 Ga0207659_10248778
246 Ga0207706_10157863
247 Ga0207665_10071202
248 Ga0207711_10019654
249 Ga0207711_10023024
250 Ga0207661_10298402
251 Ga0207640_10234178
252 Ga0207708_10120069
253 Ga0207674_10094408
254 Ga0207428_10077620
255 Ga0307408_100008158
256 Ga0316578_10121369
257 Ga0307405_10031363
258 Ga0307413_10014194
259 Ga0307413_10043987
260 Ga0307410_10008748
261 Ga0307410_10024028
262 Ga0307412_10045593
263 Ga0307409_100026721
264 Ga0307409_100097968
265 Ga0307416_100026609
266 Ga0307414_10192784
267 Ga0307411_10009375
268 Ga0307411_10243209
269 Ga0307415_100150964
270 Ga0373950_0004285
271 Ga0373938_0001234
272 Ga0373928_0002825
273 Ga0373949_0001989
274 Ga0373932_0000581
275 Ga0373939_0001473
276 Ga0373941_0000907
277 Ga0373955_0129275
278 Ga0373961_0001350
279 Ga0373962_0002739
280 Ga0373931_0001413
281 Ga0439446_0036558
282 Ga0453684_0143331
283 Ga0451576_0011210
284 Ga0495592_0011047
285 Ga0495647_0054060
286 Ga0495647_0082361
287 Ga0496102_0222740
288 Ga0496107_0045719
289 Ga0496109_0043707
290 Ga0496112_0062272
291 Ga0501034_0089019
292 Ga0501036_0181493
293 Ga0501040_0028957
294 Ga0501048_0046123
295 Ga0501074_0142403
296 Ga0501081_0280335
297 nmdc:mga05p37_177416_c1
298 nmdc:mga05p37_198943_c1
299 nmdc:mga05p37_265341_c1
300 nmdc:mga05p37_391191_c1
301 nmdc:mga05p37_478_c1
302 nmdc:mga05p37_68057_c1
303 nmdc:mga05p37_71669_c1
304 nmdc:mga05p37_8954_c1
305 nmdc:mga09592_222984_c1
306 nmdc:mga06r32_187698_c1
307 nmdc:mga08y16_33042_c1
308 nmdc:mga08y16_61124_c1
309 nmdc:mga0n895_18254_c1
310 nmdc:mga0n895_193425_c1
311 nmdc:mga0n895_491370_c1
312 nmdc:mga0n895_81713_c1
313 nmdc:mga0rr50_1982_c1
314 nmdc:mga0rr50_210223_c1
315 nmdc:mga0rr50_695_c1
316 nmdc:mga0rr50_82080_c1
317 nmdc:mga08x19_20_c1
318 nmdc:mga0a205_8811_c1
319 nmdc:mga0a205_92154_c1
320 Ga0590071_000071
321 Ga0590074_000535
322 Ga0590075_000324
323 Ga0590077_000172
324 Ga0590077_006060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

37

386

0.89

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

40

106

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y56-assembly1.cif.gz_B crystal structure of l-proline dehydrogenase from p.horikoshii 0.9264 1 377
2gah-assembly1.cif.gz_B heterotetrameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution 0.9156 1 377
1y56-assembly1.cif.gz_B crystal structure of l-proline dehydrogenase from p.horikoshii 0.9144 1 377
1vrq-assembly1.cif.gz_B crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. u-96 in complex with folinic acid 0.9128 2 379
1uxk-assembly1.cif.gz_C-2 large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface 0.9121 5 38
ID Description Score Start End Superfamily
4paaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9382 1 374 3.50.50.60
2gahB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9357 2 377 3.50.50.60
1y56B01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9247 1 377 3.50.50.60
af_A1Z6N5_34_432_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9134 8 377 3.50.50.60
af_Q3TQB2_64_479_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9122 5 375 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A3M0XQA4-F1-model_v4 FAD-binding oxidoreductase 0.9749 3 156 GO:0005737
AF-A0A2S5EK55-F1-model_v4 FAD-dependent oxidoreductase 0.9643 1 200 GO:0005737
AF-A0A6H9KCL6-F1-model_v4 FAD-binding oxidoreductase 0.9636 1 388 GO:0005737
GO:0016020
AF-A0A6H9KCL6-F1-model_v4 FAD-binding oxidoreductase 0.9563 1 388 GO:0005737
GO:0016020
AF-A0A535K041-F1-model_v4 FAD-binding oxidoreductase 0.9559 1 198 GO:0005737
GO:0016020

Map