F237326

General Info

Members Datasets Scaffolds Average Seq Length
161 141 130 146

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10309056|Ga0316579_103090562
Length 165
Sequence VPLSPRGKPRPSTTKCNAEPVALPKPVPGLVIRYAYLWRDEYRRGQEEGLKDRPCAVIVVTTGEAGDQAVTVLPVTHTPHSDPSLAVEIPIGTKRRLGLDDARSWVVLSEANRFLWPGPDLRPIRSGDPSGVAYGLLPRALFKEISTKLADAIAARAVRVVPRSE

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
3 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
4 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
5 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
6 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
7 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
8 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
9 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
10 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
11 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
12 2791355261 Rhizobium sp. J15 Isolate Nodule
13 2838048938 Rhizobium pisi 27/80 Isolate Nodule
14 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
15 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
16 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
17 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
18 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
19 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
20 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
21 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
22 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
23 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
24 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
25 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
26 2933599457 Rhizobium phaseoli M3 Isolate Nodule
27 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
79 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
86 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
87 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
88 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
108 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
127 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
128 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
138 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
139 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
140 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
141 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 73.91
Metatranscriptomes 6.83
Isolates 19.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.73
Nodule 18.01
Rhizoplane 0
Rhizosphere 71.43
Stem 0
Stem Tuber 0
Unclassified 6.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10010778 3300002067 Bacteria 2905
2 rootL2_10273527 3300003322 Bacteria 1779
3 Ga0070714_100063651 3300005435 Bacteria 3172
4 Ga0070714_100574441 3300005435 Bacteria 1081
5 Ga0070714_100808804 3300005435 Bacteria 908
6 Ga0070713_100369170 3300005436 Bacteria 1335
7 Ga0070708_100221936 3300005445 Bacteria 1772
8 Ga0070662_100215763 3300005457 Bacteria 1529
9 Ga0070706_100204931 3300005467 Bacteria 1842
10 Ga0070698_100004624 3300005471 Bacteria 15122
11 Ga0070699_100043370 3300005518 Bacteria 3893
12 Ga0070697_100370643 3300005536 Bacteria 1239
13 Ga0070697_100377460 3300005536 Bacteria 1227
14 Ga0068853_101892804 3300005539 Unclassified 578
15 Ga0070695_100327392 3300005545 Bacteria 1141
16 Ga0068855_100051057 3300005563 Bacteria 4872
17 Ga0068855_101158018 3300005563 Unclassified 806
18 Ga0068857_100083668 3300005577 Bacteria 2851
19 Ga0068854_100132852 3300005578 Unclassified 1902
20 Ga0068851_10002417 3300005834 Bacteria 8202
21 Ga0081455_10954083 3300005937 Unclassified 532
22 Ga0081539_10068157 3300005985 Bacteria 1921
23 Ga0070717_10129068 3300006028 Bacteria 2173
24 Ga0070717_10660905 3300006028 Unclassified 949
25 Ga0070715_10067239 3300006163 Bacteria 1591
26 Ga0070712_101219291 3300006175 Unclassified 655
27 Ga0099795_10086815 3300007788 Unclassified 1207
28 Ga0105240_10165154 3300009093 Bacteria 2626
29 Ga0105241_10017978 3300009174 Bacteria 5198
30 Ga0105237_10030683 3300009545 Bacteria 5458
31 Ga0123341_1000002 3300009765 Bacteria 191257
32 Ga0213875_10006199 3300021388 Bacteria 6305
33 Ga0209233_1028076 3300025261 Bacteria 1355
34 Ga0207656_10002869 3300025321 Bacteria 5875
35 Ga0207699_10141738 3300025906 Bacteria 1580
36 Ga0207684_10043122 3300025910 Bacteria 3824
37 Ga0207684_10983348 3300025910 Bacteria 707
38 Ga0207695_10003039 3300025913 Bacteria 24047
39 Ga0207671_10018988 3300025914 Bacteria 5266
40 Ga0207663_10520538 3300025916 Bacteria 926
41 Ga0207664_10542683 3300025929 Bacteria 1043
42 Ga0207667_10061359 3300025949 Bacteria 3933
43 Ga0207640_10172553 3300025981 Bacteria 1613
44 Ga0207639_10000552 3300026041 Bacteria 25704
45 Ga0207674_10143638 3300026116 Bacteria 2345
46 Ga0265319_1094296 3300028563 Bacteria 943
47 Ga0265323_10008710 3300028653 Bacteria 4172
48 Ga0265336_10004449 3300028666 Bacteria 5294
49 Ga0265338_10000422 3300028800 Bacteria 75820
50 Ga0265338_10954935 3300028800 Bacteria 582
51 Ga0307511_10029266 3300030521 Plasmid 4978
52 Ga0265330_10014314 3300031235 Bacteria 3682
53 Ga0265330_10068912 3300031235 Bacteria 1532
54 Ga0265328_10001277 3300031239 Bacteria 11613
55 Ga0265328_10008564 3300031239 Bacteria 4211
56 Ga0265328_10009464 3300031239 Bacteria 3965
57 Ga0265328_10010405 3300031239 Bacteria 3747
58 Ga0265325_10003356 3300031241 Bacteria 10509
59 Ga0265325_10027658 3300031241 Bacteria 3063
60 Ga0265325_10355019 3300031241 Unclassified 647
61 Ga0265339_10013977 3300031249 Bacteria 4854
62 Ga0265331_10000477 3300031250 Bacteria 38363
63 Ga0265327_10004007 3300031251 Bacteria 13412
64 Ga0265327_10007089 3300031251 Bacteria 8765
65 Ga0265327_10013788 3300031251 Bacteria 5341
66 Ga0265316_10010841 3300031344 Bacteria 8278
67 Ga0265316_10392052 3300031344 Bacteria 1001
68 Ga0307508_10716413 3300031616 Unclassified 611
69 Ga0316579_10309056 3300031691 Unclassified 764
70 Ga0265314_10001086 3300031711 Bacteria 31455
71 Ga0316593_10014839 3300032168 Bacteria 2333
72 Ga0373934_0511657 3300035086 Unclassified 505
73 Ga0373923_0095100 3300035111 Bacteria 1308
74 Ga0436364_0406474 3300037853 Bacteria 6192
75 Ga0400486_11032 3300038742 Bacteria 5639
76 Ga0400483_228751 3300039062 Bacteria 40954
77 Ga0400487_42907 3300039110 Bacteria 2706
78 Ga0451577_0026168 3300042876 Bacteria 5284
79 Ga0453684_0435223 3300044712 Bacteria 1462
80 Ga0451576_0036956 3300045051 Bacteria 5174
81 Ga0495592_0087036 3300046454 Bacteria 2249
82 Ga0495641_0346898 3300046461 Bacteria 671
83 Ga0495651_0031259 3300046462 Bacteria 4153
84 Ga0495653_0056652 3300046463 Bacteria 2987
85 Ga0495664_0010740 3300046477 Bacteria 5148
86 Ga0495608_0029686 3300046511 Bacteria 3707
87 Ga0495630_0140835 3300046517 Unclassified 1834
88 Ga0495652_0009876 3300046529 Bacteria 8650
89 Ga0495586_0232350 3300046535 Bacteria 1050
90 Ga0495587_0047699 3300046536 Bacteria 2539
91 Ga0495635_0050899 3300046663 Bacteria 2855
92 Ga0495657_0021637 3300046675 Bacteria 4613
93 Ga0495623_0028889 3300046679 Bacteria 3568
94 Ga0495600_0049525 3300046809 Bacteria 2741
95 Ga0495681_0045882 3300047470 Bacteria 2088
96 Ga0495684_0235671 3300047471 Unclassified 1337
97 Ga0495682_0221733 3300049460 Unclassified 670
98 Ga0501031_0004148 3300049568 Bacteria 9357
99 Ga0501031_0039691 3300049568 Bacteria 3072
100 Ga0501032_0028230 3300049569 Bacteria 3855
101 Ga0501032_0207023 3300049569 Bacteria 1279
102 Ga0501034_0010480 3300049571 Bacteria 9652
103 Ga0501037_0001417 3300049573 Bacteria 17598
104 Ga0501037_0049880 3300049573 Bacteria 3064
105 Ga0501038_0009818 3300049574 Bacteria 8761
106 Ga0501040_0195640 3300049576 Bacteria 1435
107 Ga0501043_0025233 3300049579 Bacteria 4662
108 Ga0501047_0018327 3300049581 Bacteria 6709
109 Ga0501048_0001867 3300049582 Bacteria 15985
110 Ga0501068_0157080 3300049584 Bacteria 1432
111 Ga0501070_0114847 3300049586 Bacteria 2224
112 Ga0501072_0294949 3300049588 Bacteria 1289
113 Ga0501073_0455588 3300049589 Bacteria 884
114 Ga0501044_0005402 3300049823 Bacteria 14194
115 Ga0501045_0000591 3300049824 Bacteria 22795
116 nmdc:mga03n38_391695_c1 3300050490 Bacteria 763
117 nmdc:mga07m45_193755_c1 3300050496 Bacteria 1182
118 Ga0500643_115034 3300053087 Bacteria 725
119 Ga0500592_000020 3300053116 Bacteria 56760
120 Ga0500627_0000016 3300053158 Bacteria 125231
121 Ga0587073_0021856 3300059492 Bacteria 1235
122 Ga0587073_0176891 3300059492 Bacteria 623
123 Ga0587080_010111 3300059503 Bacteria 1386
124 Ga0587083_0021906 3300059505 Bacteria 1192
125 Ga0587089_009237 3300059509 Bacteria 1206
126 Ga0587091_025053 3300059511 Bacteria 1076
127 Ga0587076_013596 3300059645 Bacteria 1238
128 Ga0587114_006554 3300059655 Bacteria 1306
129 Ga0587060_020573 3300060243 Unclassified 627
130 Ga0587111_0214453 3300060346 Bacteria 553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2718218235 2720628707 128
2 iso_pu_bacteria 2718218269 2720772655 128
3 iso_pu_bacteria 2721755819 2724092684 128
4 iso_pu_bacteria 8005497431 8005501918 128
5 iso_pu_bacteria 8005619151 8005624161 128
6 iso_pu_bacteria 8005668836 8005673340 128
7 3300047470 Ga0495681_0045882 Ga0495681_0045882_1448_1852 131
8 3300021388 Ga0213875_10006199 Ga0213875_100061993 134
9 3300037853 Ga0436364_0406474 Ga0436364_0406474_1686_2126 134
10 iso_pu_bacteria 2509276021 2509390599 134
11 3300006028 Ga0070717_10129068 Ga0070717_101290683 135
12 3300059511 Ga0587091_025053 Ga0587091_025053_536_955 136
13 3300028800 Ga0265338_10954935 Ga0265338_109549351 140
14 iso_pu_bacteria 2524023209 2524460060 140
15 iso_pu_bacteria 2718218232 2720610136 140
16 iso_pu_bacteria 2721755685 2723569859 140
17 iso_pu_bacteria 2721755822 2724101406 140
18 iso_pu_bacteria 2721755823 2724113070 140
19 iso_pu_bacteria 2791355259 2793315099 140
20 iso_pu_bacteria 2791355261 2793330670 140
21 iso_pu_bacteria 2838048938 2838049858 140
22 iso_pu_bacteria 2838068647 2838069519 140
23 iso_pu_bacteria 2842264693 2842264894 140
24 iso_pu_bacteria 2842298080 2842298715 140
25 iso_pu_bacteria 2842357229 2842359417 140
26 iso_pu_bacteria 2842422224 2842422710 140
27 iso_pu_bacteria 2842428310 2842429053 140
28 iso_pu_bacteria 2842434925 2842435666 140
29 iso_pu_bacteria 2842441272 2842441473 140
30 iso_pu_bacteria 2842469257 2842469996 140
31 iso_pu_bacteria 2933599457 2933600182 140
32 iso_pu_bacteria 8005430974 8005436662 140
33 iso_pu_bacteria 8005626139 8005629424 140
34 3300028563 Ga0265319_1094296 Ga0265319_10942962 141
35 3300028653 Ga0265323_10008710 Ga0265323_100087102 141
36 3300028666 Ga0265336_10004449 Ga0265336_100044496 141
37 3300028800 Ga0265338_10000422 Ga0265338_1000042241 141
38 iso_pu_bacteria 2513237351 2514590015 141
39 iso_pu_bacteria 2841911363 2841915524 141
40 iso_pu_bacteria 2841917233 2841920726 141
41 iso_pu_bacteria 2842447887 2842448458 141
42 3300046454 Ga0495592_0087036 Ga0495592_0087036_171_644 142
43 3300046462 Ga0495651_0031259 Ga0495651_0031259_429_902 142
44 3300046463 Ga0495653_0056652 Ga0495653_0056652_471_944 142
45 3300046477 Ga0495664_0010740 Ga0495664_0010740_1800_2273 142
46 3300046511 Ga0495608_0029686 Ga0495608_0029686_1058_1531 142
47 3300046517 Ga0495630_0140835 Ga0495630_0140835_766_1239 142
48 3300046529 Ga0495652_0009876 Ga0495652_0009876_7674_8147 142
49 3300046536 Ga0495587_0047699 Ga0495587_0047699_1378_1851 142
50 3300046663 Ga0495635_0050899 Ga0495635_0050899_159_632 142
51 3300046675 Ga0495657_0021637 Ga0495657_0021637_2812_3285 142
52 3300046679 Ga0495623_0028889 Ga0495623_0028889_18_491 142
53 3300046809 Ga0495600_0049525 Ga0495600_0049525_1337_1810 142
54 3300047471 Ga0495684_0235671 Ga0495684_0235671_305_778 142
55 3300005937 Ga0081455_10954083 Ga0081455_109540831 143
56 3300046461 Ga0495641_0346898 Ga0495641_0346898_172_606 143
57 3300003322 rootL2_10273527 rootL2_102735273 144
58 3300005445 Ga0070708_100221936 Ga0070708_1002219362 144
59 3300005467 Ga0070706_100204931 Ga0070706_1002049313 144
60 3300005471 Ga0070698_100004624 Ga0070698_10000462414 144
61 3300005518 Ga0070699_100043370 Ga0070699_1000433705 144
62 3300005536 Ga0070697_100377460 Ga0070697_1003774602 144
63 3300005577 Ga0068857_100083668 Ga0068857_1000836683 144
64 3300009765 Ga0123341_1000002 Ga0123341_1000002118 144
65 3300025261 Ga0209233_1028076 Ga0209233_10280763 144
66 3300025910 Ga0207684_10043122 Ga0207684_100431223 144
67 3300026116 Ga0207674_10143638 Ga0207674_101436383 144
68 3300031235 Ga0265330_10014314 Ga0265330_100143145 144
69 3300031235 Ga0265330_10068912 Ga0265330_100689123 144
70 3300031239 Ga0265328_10001277 Ga0265328_100012779 144
71 3300031239 Ga0265328_10008564 Ga0265328_100085645 144
72 3300031239 Ga0265328_10009464 Ga0265328_100094646 144
73 3300031241 Ga0265325_10003356 Ga0265325_100033567 144
74 3300031241 Ga0265325_10355019 Ga0265325_103550191 144
75 3300031250 Ga0265331_10000477 Ga0265331_1000047710 144
76 3300031251 Ga0265327_10013788 Ga0265327_100137889 144
77 3300031344 Ga0265316_10392052 Ga0265316_103920522 144
78 3300031616 Ga0307508_10716413 Ga0307508_107164132 144
79 3300050490 nmdc:mga03n38_391695_c1 nmdc:mga03n38_391695_c1_60_509 144
80 3300050496 nmdc:mga07m45_193755_c1 nmdc:mga07m45_193755_c1_216_665 144
81 3300059492 Ga0587073_0021856 Ga0587073_0021856_538_981 144
82 3300059492 Ga0587073_0176891 Ga0587073_0176891_94_543 144
83 3300059503 Ga0587080_010111 Ga0587080_010111_391_834 144
84 3300059505 Ga0587083_0021906 Ga0587083_0021906_502_945 144
85 3300059509 Ga0587089_009237 Ga0587089_009237_257_700 144
86 3300059645 Ga0587076_013596 Ga0587076_013596_536_979 144
87 3300059655 Ga0587114_006554 Ga0587114_006554_510_953 144
88 3300060243 Ga0587060_020573 Ga0587060_020573_46_489 144
89 3300060346 Ga0587111_0214453 Ga0587111_0214453_25_474 144
90 3300002067 JGI24735J21928_10010778 JGI24735J21928_100107785 145
91 3300005435 Ga0070714_100063651 Ga0070714_1000636515 145
92 3300005435 Ga0070714_100574441 Ga0070714_1005744411 145
93 3300005435 Ga0070714_100808804 Ga0070714_1008088042 145
94 3300005436 Ga0070713_100369170 Ga0070713_1003691703 145
95 3300005457 Ga0070662_100215763 Ga0070662_1002157633 145
96 3300005536 Ga0070697_100370643 Ga0070697_1003706432 145
97 3300005539 Ga0068853_101892804 Ga0068853_1018928041 145
98 3300005545 Ga0070695_100327392 Ga0070695_1003273922 145
99 3300005563 Ga0068855_100051057 Ga0068855_1000510576 145
100 3300005563 Ga0068855_101158018 Ga0068855_1011580181 145
101 3300005578 Ga0068854_100132852 Ga0068854_1001328524 145
102 3300005834 Ga0068851_10002417 Ga0068851_1000241712 145
103 3300005985 Ga0081539_10068157 Ga0081539_100681573 145
104 3300006028 Ga0070717_10660905 Ga0070717_106609052 145
105 3300006163 Ga0070715_10067239 Ga0070715_100672393 145
106 3300006175 Ga0070712_101219291 Ga0070712_1012192911 145
107 3300007788 Ga0099795_10086815 Ga0099795_100868152 145
108 3300009093 Ga0105240_10165154 Ga0105240_101651544 145
109 3300009174 Ga0105241_10017978 Ga0105241_100179785 145
110 3300009545 Ga0105237_10030683 Ga0105237_100306836 145
111 3300025321 Ga0207656_10002869 Ga0207656_100028698 145
112 3300025906 Ga0207699_10141738 Ga0207699_101417382 145
113 3300025910 Ga0207684_10983348 Ga0207684_109833481 145
114 3300025913 Ga0207695_10003039 Ga0207695_1000303925 145
115 3300025914 Ga0207671_10018988 Ga0207671_100189885 145
116 3300025916 Ga0207663_10520538 Ga0207663_105205381 145
117 3300025929 Ga0207664_10542683 Ga0207664_105426832 145
118 3300025949 Ga0207667_10061359 Ga0207667_100613595 145
119 3300025981 Ga0207640_10172553 Ga0207640_101725533 145
120 3300026041 Ga0207639_10000552 Ga0207639_100005524 145
121 3300030521 Ga0307511_10029266 Ga0307511_100292667 145
122 3300031239 Ga0265328_10010405 Ga0265328_100104053 145
123 3300031241 Ga0265325_10027658 Ga0265325_100276582 145
124 3300031249 Ga0265339_10013977 Ga0265339_100139774 145
125 3300031251 Ga0265327_10004007 Ga0265327_100040073 145
126 3300031251 Ga0265327_10007089 Ga0265327_100070895 145
127 3300031344 Ga0265316_10010841 Ga0265316_100108415 145
128 3300031691 Ga0316579_10309056 Ga0316579_103090562 145
129 3300031711 Ga0265314_10001086 Ga0265314_1000108622 145
130 3300032168 Ga0316593_10014839 Ga0316593_100148393 145
131 3300035086 Ga0373934_0511657 Ga0373934_0511657_15_452 145
132 3300035111 Ga0373923_0095100 Ga0373923_0095100_407_844 145
133 3300038742 Ga0400486_11032 Ga0400486_11032_4453_4890 145
134 3300039062 Ga0400483_228751 Ga0400483_228751_14617_15054 145
135 3300039110 Ga0400487_42907 Ga0400487_42907_1558_1995 145
136 3300042876 Ga0451577_0026168 Ga0451577_0026168_679_1119 145
137 3300044712 Ga0453684_0435223 Ga0453684_0435223_337_777 145
138 3300045051 Ga0451576_0036956 Ga0451576_0036956_707_1147 145
139 3300046535 Ga0495586_0232350 Ga0495586_0232350_179_616 145
140 3300049460 Ga0495682_0221733 Ga0495682_0221733_78_515 145
141 3300049568 Ga0501031_0004148 Ga0501031_0004148_773_1222 145
142 3300049568 Ga0501031_0039691 Ga0501031_0039691_82_531 145
143 3300049569 Ga0501032_0028230 Ga0501032_0028230_2542_2991 145
144 3300049569 Ga0501032_0207023 Ga0501032_0207023_529_978 145
145 3300049571 Ga0501034_0010480 Ga0501034_0010480_338_787 145
146 3300049573 Ga0501037_0001417 Ga0501037_0001417_4281_4730 145
147 3300049573 Ga0501037_0049880 Ga0501037_0049880_2317_2766 145
148 3300049574 Ga0501038_0009818 Ga0501038_0009818_5396_5845 145
149 3300049576 Ga0501040_0195640 Ga0501040_0195640_816_1265 145
150 3300049579 Ga0501043_0025233 Ga0501043_0025233_2542_2991 145
151 3300049581 Ga0501047_0018327 Ga0501047_0018327_5396_5845 145
152 3300049582 Ga0501048_0001867 Ga0501048_0001867_1222_1671 145
153 3300049584 Ga0501068_0157080 Ga0501068_0157080_120_569 145
154 3300049586 Ga0501070_0114847 Ga0501070_0114847_520_969 145
155 3300049588 Ga0501072_0294949 Ga0501072_0294949_696_1145 145
156 3300049589 Ga0501073_0455588 Ga0501073_0455588_408_857 145
157 3300049823 Ga0501044_0005402 Ga0501044_0005402_8785_9222 145
158 3300049824 Ga0501045_0000591 Ga0501045_0000591_867_1316 145
159 3300053087 Ga0500643_115034 Ga0500643_115034_10_447 145
160 3300053116 Ga0500592_000020 Ga0500592_000020_13002_13439 145
161 3300053158 Ga0500627_0000016 Ga0500627_0000016_80668_81105 145

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hq9-assembly1.cif.gz_A crystal structure of the tudor domain of human ercc6-l2 0.8016 4 53
5xe3-assembly1.cif.gz_A endoribonuclease in complex with its cognate antitoxin from mycobacterial species 0.7872 5 134
6hq9-assembly2.cif.gz_B crystal structure of the tudor domain of human ercc6-l2 0.7871 4 54
5uct-assembly1.cif.gz_A-2 mycobacterium tuberculosis toxin mazf-mt6 0.7694 7 134
5cca-assembly1.cif.gz_B crystal structure of mtb toxin 0.7665 33 132
ID Description Score Start End Superfamily
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.7986 6 134 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.7665 33 132 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.7562 6 134 2.30.30.110
af_Q9TYU5_22_102_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.754 7 54 2.30.30.140
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.7341 1 136 2.30.30.110
ID Description Score Start End GO Terms
AF-B0T8W1-F1-model_v4 Growth inhibitor PemK 0.981 1 145 GO:0003677
AF-A0A3N1L397-F1-model_v4 PemK-like, MazF-like toxin of type II toxin-antitoxin system 0.9803 1 144
AF-A0A3D4MH79-F1-model_v4 Growth inhibitor PemK 0.9799 1 145
AF-A0A367W743-F1-model_v4 deleted 0.9791 1 144
AF-A0A4Y1MQR1-F1-model_v4 Growth inhibitor PemK 0.9776 1 145 GO:0003677

Feature Viewer

pLDDT pTM Quality
92.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map