F237261

General Info

Members Datasets Scaffolds Average Seq Length
161 103 161 365

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10015235|Ga0265338_100152352
Length 381
Sequence MQFTPGAAGPTVPAMTIGLPKEIKPQEHRVALVPSAAYQLIKHGHRVLVERGAGAGSGYPDADYEAAGASLVDSHAGVFAEAGLVVKVKEPLPEEYPLLRPGQILFTYLHLAADRRLTEALMKTGVTGIAYETIEVNRRLPLLEPMSEIAGRMSILVGGYFLAKHHGGSGTLLGGVPGVLPGKVVVLGGGVAGINAARMAIGLGADVTILEVDLERMRFLDITLHTSHTLYSSEAHLLDLLPSVDLLIGAVLVPGAKAPRLIRRDMLRRMRPGSVLVDIAIDQGGCAETSHPTTHNDPVFVEEGVTHYCVANMPGAYARTATQALTNVTHRYIELLADHGLAEACRIQPALAGGINIQNGQITCQAVADAHGVAFTPPQLG

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
54 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
55 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
69 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
70 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
81 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
90 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
100 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
101 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
102 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
103 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 3.11
Rhizosphere 90.68
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10040805 3300003320 Bacteria 5801
2 rootH2_10050510 3300003320 Bacteria 6718
3 rootL2_10122038 3300003322 Bacteria 9198
4 Ga0065715_10000368 3300005293 Bacteria 15488
5 Ga0070689_100004031 3300005340 Bacteria 9882
6 Ga0070668_100000055 3300005347 Bacteria 70835
7 Ga0070671_100005756 3300005355 Bacteria 9873
8 Ga0070714_100001583 3300005435 Bacteria 16542
9 Ga0070665_100108300 3300005548 Bacteria 2781
10 Ga0070665_100226029 3300005548 Bacteria 1872
11 Ga0068855_100001921 3300005563 Bacteria 25785
12 Ga0068856_100068724 3300005614 Bacteria 3502
13 Ga0068859_100134933 3300005617 Bacteria 2540
14 Ga0068859_100144857 3300005617 Bacteria 2450
15 Ga0068863_100000030 3300005841 Bacteria 176023
16 Ga0068863_100032422 3300005841 Bacteria 4980
17 Ga0068863_100331205 3300005841 Bacteria 1480
18 Ga0068858_100047507 3300005842 Bacteria 3979
19 Ga0068862_100059076 3300005844 Bacteria 3291
20 Ga0081455_10000027 3300005937 Bacteria 156832
21 Ga0081538_10022690 3300005981 Bacteria 4540
22 Ga0070712_100106961 3300006175 Bacteria 2080
23 Ga0075431_100021905 3300006847 Bacteria 6533
24 Ga0097620_100134928 3300006931 Bacteria 2540
25 Ga0097620_100144852 3300006931 Bacteria 2450
26 Ga0105240_10000508 3300009093 Bacteria 71878
27 Ga0105240_10003977 3300009093 Bacteria 22806
28 Ga0105240_10005677 3300009093 Bacteria 18522
29 Ga0105240_10054894 3300009093 Bacteria 4990
30 Ga0105240_10064074 3300009093 Bacteria 4569
31 Ga0111539_10177688 3300009094 Bacteria 2487
32 Ga0111539_10398027 3300009094 Bacteria 1604
33 Ga0111539_10453904 3300009094 Bacteria 1493
34 Ga0105245_10204049 3300009098 Bacteria 1900
35 Ga0105242_10212792 3300009176 Bacteria 1724
36 Ga0105238_10013396 3300009551 Bacteria 8278
37 Ga0105249_10138093 3300009553 Bacteria 2335
38 Ga0157374_10000026 3300013296 Bacteria 238236
39 Ga0157375_10000070 3300013308 Bacteria 108417
40 Ga0163163_10059423 3300014325 Bacteria 3782
41 Ga0157376_10003838 3300014969 Bacteria 10390
42 Ga0157376_10052531 3300014969 Bacteria 3389
43 Ga0213872_10004260 3300021361 Bacteria 7664
44 Ga0213872_10063852 3300021361 Bacteria 1664
45 Ga0209050_1000999 3300025298 Bacteria 35524
46 Ga0207699_10106352 3300025906 Bacteria 1791
47 Ga0207695_10001082 3300025913 Bacteria 47597
48 Ga0207695_10020213 3300025913 Bacteria 7633
49 Ga0207695_10024878 3300025913 Bacteria 6720
50 Ga0207695_10114295 3300025913 Bacteria 2675
51 Ga0207695_10175976 3300025913 Bacteria 2062
52 Ga0207694_10160839 3300025924 Bacteria 1814
53 Ga0207644_10000186 3300025931 Bacteria 44897
54 Ga0207670_10014324 3300025936 Bacteria 4705
55 Ga0207667_10003590 3300025949 Bacteria 19165
56 Ga0207712_10091875 3300025961 Bacteria 2236
57 Ga0207668_10000095 3300025972 Bacteria 63349
58 Ga0207703_10020599 3300026035 Bacteria 5159
59 Ga0207641_10000001 3300026088 Bacteria 1180841
60 Ga0207641_10064959 3300026088 Bacteria 3120
61 Ga0207641_10090002 3300026088 Bacteria 2683
62 Ga0207641_10295664 3300026088 Bacteria 1528
63 Ga0207648_10274402 3300026089 Bacteria 1507
64 Ga0268264_10015655 3300028381 Bacteria 6210
65 Ga0265334_10004401 3300028573 Bacteria 6255
66 Ga0265323_10000092 3300028653 Bacteria 51020
67 Ga0265323_10012791 3300028653 Bacteria 3358
68 Ga0265323_10020277 3300028653 Bacteria 2561
69 Ga0265322_10001975 3300028654 Bacteria 6468
70 Ga0265322_10006922 3300028654 Bacteria 3322
71 Ga0265338_10015235 3300028800 Bacteria 8469
72 Ga0265338_10104688 3300028800 Bacteria 2295
73 Ga0307511_10006584 3300030521 Bacteria 11703
74 Ga0265330_10042041 3300031235 Bacteria 2026
75 Ga0265329_10001167 3300031242 Bacteria 12920
76 Ga0265329_10017891 3300031242 Bacteria 2432
77 Ga0265339_10095153 3300031249 Bacteria 1556
78 Ga0265316_10019412 3300031344 Bacteria 5816
79 Ga0265316_10058814 3300031344 Bacteria 2992
80 Ga0265316_10086674 3300031344 Bacteria 2393
81 Ga0265316_10174270 3300031344 Bacteria 1604
82 Ga0265314_10000115 3300031711 Bacteria 124024
83 Ga0265314_10100006 3300031711 Bacteria 1866
84 Ga0265342_10035808 3300031712 Bacteria 3034
85 Ga0265342_10070934 3300031712 Bacteria 2031
86 Ga0316593_10009964 3300032168 Bacteria 2707
87 Ga0373954_0013681 3300035118 Bacteria 3615
88 Ga0316574_0035765 3300035398 Bacteria 3037
89 Ga0373931_0099323 3300035691 Bacteria 1635
90 Ga0373927_0026033 3300035695 Bacteria 3824
91 Ga0373927_0027308 3300035695 Bacteria 3727
92 Ga0373947_0037004 3300035725 Bacteria 2895
93 Ga0373925_0002091 3300037068 Bacteria 16400
94 Ga0395905_0192408 3300037471 Bacteria 1913
95 Ga0395905_0255431 3300037471 Bacteria 1637
96 Ga0400483_023782 3300039062 Bacteria 5005
97 Ga0400483_202923 3300039062 Bacteria 4942
98 Ga0436365_1435552 3300039437 Bacteria 3785
99 Ga0436361_0195038 3300039447 Bacteria 8948
100 Ga0436361_0230187 3300039447 Bacteria 8214
101 Ga0436361_1031389 3300039447 Bacteria 10909
102 Ga0436363_0568219 3300039450 Bacteria 10993
103 Ga0436362_0201301 3300039453 Unclassified 2026
104 Ga0451795_0664674 3300041456 Bacteria 6271
105 Ga0439460_0025175 3300042461 Bacteria 1655
106 Ga0451577_0000744 3300042876 Bacteria 50061
107 Ga0451577_0036929 3300042876 Bacteria 4399
108 Ga0451577_0040635 3300042876 Bacteria 4175
109 Ga0451577_0045089 3300042876 Bacteria 3947
110 Ga0451577_0096387 3300042876 Bacteria 2641
111 Ga0466972_0099196 3300044658 Bacteria 1379
112 Ga0453683_0000002 3300044673 Bacteria 1244396
113 Ga0453683_0000131 3300044673 Bacteria 109628
114 Ga0453684_0050876 3300044712 Bacteria 5441
115 Ga0453684_0170901 3300044712 Bacteria 2562
116 Ga0453684_0326297 3300044712 Bacteria 1737
117 Ga0451576_0019927 3300045051 Bacteria 7311
118 Ga0451576_0058795 3300045051 Unclassified 4015
119 Ga0451576_0147137 3300045051 Bacteria 2456
120 Ga0451576_0188449 3300045051 Bacteria 2154
121 Ga0451576_0265608 3300045051 Bacteria 1794
122 Ga0451576_0283028 3300045051 Bacteria 1734
123 Ga0451576_0545519 3300045051 Bacteria 1218
124 Ga0495592_0000386 3300046454 Bacteria 34513
125 Ga0495662_0021040 3300046476 Bacteria 3155
126 Ga0495664_0016040 3300046477 Bacteria 4266
127 Ga0495618_0022384 3300046514 Bacteria 3903
128 Ga0495628_0000208 3300046516 Bacteria 51288
129 Ga0495628_0175931 3300046516 Bacteria 1621
130 Ga0495630_0000031 3300046517 Bacteria 135085
131 Ga0495630_0028955 3300046517 Bacteria 4116
132 Ga0495666_0004319 3300046526 Bacteria 7175
133 Ga0495666_0054024 3300046526 Bacteria 1927
134 Ga0495640_0070398 3300046533 Bacteria 2350
135 Ga0495586_0000016 3300046535 Bacteria 126380
136 Ga0495586_0000681 3300046535 Bacteria 19369
137 Ga0495645_0003416 3300046543 Bacteria 10764
138 Ga0495645_0065068 3300046543 Bacteria 2638
139 Ga0495668_0033049 3300046616 Bacteria 2908
140 Ga0495634_0053407 3300046642 Bacteria 2707
141 Ga0495634_0072833 3300046642 Bacteria 2259
142 Ga0495635_0076369 3300046663 Bacteria 2296
143 Ga0495599_0006549 3300046678 Bacteria 7029
144 Ga0495658_0068915 3300046683 Unclassified 2049
145 Ga0495669_0159236 3300046684 Bacteria 1071
146 Ga0495613_0052816 3300046689 Bacteria 2992
147 Ga0495674_0007026 3300047319 Bacteria 10771
148 Ga0495674_0007679 3300047319 Bacteria 10302
149 Ga0495676_0002290 3300047321 Bacteria 16987
150 Ga0495675_0106727 3300047444 Bacteria 1750
151 Ga0495684_0047774 3300047471 Bacteria 3273
152 Ga0495684_0312350 3300047471 Bacteria 1126
153 Ga0496102_0123201 3300048905 Bacteria 2422
154 Ga0496110_0140839 3300048913 Bacteria 2180
155 Ga0496110_0409938 3300048913 Bacteria 1235
156 Ga0496115_0002091 3300048918 Bacteria 14303
157 Ga0501223_017187 3300049663 Bacteria 1428
158 Ga0501257_000138 3300049686 Bacteria 16649
159 Ga0501083_0001577 3300049744 Bacteria 15575
160 Ga0501280_010730 3300049776 Bacteria 1277
161 Ga0500568_0021054 3300053139 Bacteria 2812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046543 Ga0495645_0065068 Ga0495645_0065068_23_955 310
2 3300047471 Ga0495684_0312350 Ga0495684_0312350_61_1059 332
3 3300026089 Ga0207648_10274402 Ga0207648_102744021 333
4 3300046684 Ga0495669_0159236 Ga0495669_0159236_60_1061 333
5 3300042461 Ga0439460_0025175 Ga0439460_0025175_18_1142 341
6 3300044658 Ga0466972_0099196 Ga0466972_0099196_63_1175 342
7 3300005563 Ga0068855_100001921 Ga0068855_10000192125 348
8 3300009093 Ga0105240_10005677 Ga0105240_100056773 348
9 3300025913 Ga0207695_10024878 Ga0207695_100248785 348
10 3300025949 Ga0207667_10003590 Ga0207667_100035906 348
11 3300049663 Ga0501223_017187 Ga0501223_017187_97_1221 348
12 3300049686 Ga0501257_000138 Ga0501257_000138_13313_14437 348
13 3300049776 Ga0501280_010730 Ga0501280_010730_10_1134 348
14 3300042876 Ga0451577_0040635 Ga0451577_0040635_3101_4150 349
15 3300005937 Ga0081455_10000027 Ga0081455_1000002766 350
16 3300005614 Ga0068856_100068724 Ga0068856_1000687242 351
17 3300046616 Ga0495668_0033049 Ga0495668_0033049_689_1783 351
18 3300048913 Ga0496110_0140839 Ga0496110_0140839_68_1192 351
19 3300048913 Ga0496110_0409938 Ga0496110_0409938_90_1214 351
20 3300005981 Ga0081538_10022690 Ga0081538_100226905 354
21 3300039062 Ga0400483_023782 Ga0400483_023782_2996_4108 355
22 3300039062 Ga0400483_202923 Ga0400483_202923_2885_3997 355
23 3300005347 Ga0070668_100000055 Ga0070668_10000005523 357
24 3300005355 Ga0070671_100005756 Ga0070671_1000057562 357
25 3300005548 Ga0070665_100108300 Ga0070665_1001083004 357
26 3300005617 Ga0068859_100144857 Ga0068859_1001448573 357
27 3300005841 Ga0068863_100000030 Ga0068863_10000003054 357
28 3300005844 Ga0068862_100059076 Ga0068862_1000590765 357
29 3300006931 Ga0097620_100144852 Ga0097620_1001448523 357
30 3300009553 Ga0105249_10138093 Ga0105249_101380932 357
31 3300025931 Ga0207644_10000186 Ga0207644_1000018617 357
32 3300025961 Ga0207712_10091875 Ga0207712_100918752 357
33 3300025972 Ga0207668_10000095 Ga0207668_1000009541 357
34 3300026088 Ga0207641_10000001 Ga0207641_10000001229 357
35 3300028381 Ga0268264_10015655 Ga0268264_100156553 357
36 3300006847 Ga0075431_100021905 Ga0075431_1000219052 360
37 3300009094 Ga0111539_10177688 Ga0111539_101776883 360
38 3300044673 Ga0453683_0000131 Ga0453683_0000131_78999_80126 360
39 3300003320 rootH2_10050510 rootH2_100505101 361
40 3300035695 Ga0373927_0026033 Ga0373927_0026033_2660_3745 361
41 3300046663 Ga0495635_0076369 Ga0495635_0076369_938_2038 361
42 3300009551 Ga0105238_10013396 Ga0105238_100133962 362
43 3300013308 Ga0157375_10000070 Ga0157375_1000007050 362
44 3300025924 Ga0207694_10160839 Ga0207694_101608392 362
45 3300025906 Ga0207699_10106352 Ga0207699_101063522 363
46 3300009094 Ga0111539_10398027 Ga0111539_103980272 364
47 3300021361 Ga0213872_10004260 Ga0213872_100042606 364
48 3300021361 Ga0213872_10063852 Ga0213872_100638522 364
49 3300039447 Ga0436361_0195038 Ga0436361_0195038_5613_6707 364
50 3300039447 Ga0436361_0230187 Ga0436361_0230187_2308_3402 364
51 3300039447 Ga0436361_1031389 Ga0436361_1031389_5863_6957 364
52 3300039453 Ga0436362_0201301 Ga0436362_0201301_103_1197 364
53 3300005842 Ga0068858_100047507 Ga0068858_1000475072 365
54 3300009093 Ga0105240_10064074 Ga0105240_100640744 365
55 3300025913 Ga0207695_10175976 Ga0207695_101759762 365
56 3300026035 Ga0207703_10020599 Ga0207703_100205992 365
57 3300026088 Ga0207641_10064959 Ga0207641_100649593 365
58 3300030521 Ga0307511_10006584 Ga0307511_100065843 365
59 3300044673 Ga0453683_0000002 Ga0453683_0000002_389155_390258 365
60 3300045051 Ga0451576_0019927 Ga0451576_0019927_1383_2486 365
61 3300049744 Ga0501083_0001577 Ga0501083_0001577_3992_5110 365
62 3300003320 rootH2_10040805 rootH2_100408055 366
63 3300003322 rootL2_10122038 rootL2_101220385 366
64 3300005293 Ga0065715_10000368 Ga0065715_100003685 366
65 3300005340 Ga0070689_100004031 Ga0070689_1000040311 366
66 3300005435 Ga0070714_100001583 Ga0070714_1000015832 366
67 3300005548 Ga0070665_100226029 Ga0070665_1002260292 366
68 3300005617 Ga0068859_100134933 Ga0068859_1001349332 366
69 3300005841 Ga0068863_100032422 Ga0068863_1000324224 366
70 3300005841 Ga0068863_100331205 Ga0068863_1003312052 366
71 3300006175 Ga0070712_100106961 Ga0070712_1001069611 366
72 3300006931 Ga0097620_100134928 Ga0097620_1001349282 366
73 3300009093 Ga0105240_10000508 Ga0105240_1000050813 366
74 3300009093 Ga0105240_10003977 Ga0105240_100039776 366
75 3300009093 Ga0105240_10054894 Ga0105240_100548943 366
76 3300009094 Ga0111539_10453904 Ga0111539_104539042 366
77 3300009098 Ga0105245_10204049 Ga0105245_102040492 366
78 3300009176 Ga0105242_10212792 Ga0105242_102127922 366
79 3300013296 Ga0157374_10000026 Ga0157374_10000026228 366
80 3300014325 Ga0163163_10059423 Ga0163163_100594231 366
81 3300014969 Ga0157376_10003838 Ga0157376_100038388 366
82 3300014969 Ga0157376_10052531 Ga0157376_100525311 366
83 3300025298 Ga0209050_1000999 Ga0209050_100099924 366
84 3300025913 Ga0207695_10001082 Ga0207695_1000108213 366
85 3300025913 Ga0207695_10020213 Ga0207695_100202138 366
86 3300025913 Ga0207695_10114295 Ga0207695_101142952 366
87 3300025936 Ga0207670_10014324 Ga0207670_100143241 366
88 3300026088 Ga0207641_10090002 Ga0207641_100900022 366
89 3300026088 Ga0207641_10295664 Ga0207641_102956641 366
90 3300028573 Ga0265334_10004401 Ga0265334_100044013 366
91 3300028653 Ga0265323_10000092 Ga0265323_1000009235 366
92 3300028653 Ga0265323_10012791 Ga0265323_100127912 366
93 3300028653 Ga0265323_10020277 Ga0265323_100202771 366
94 3300028654 Ga0265322_10001975 Ga0265322_100019754 366
95 3300028654 Ga0265322_10006922 Ga0265322_100069222 366
96 3300028800 Ga0265338_10015235 Ga0265338_100152352 366
97 3300028800 Ga0265338_10104688 Ga0265338_101046882 366
98 3300031235 Ga0265330_10042041 Ga0265330_100420412 366
99 3300031242 Ga0265329_10001167 Ga0265329_1000116711 366
100 3300031242 Ga0265329_10017891 Ga0265329_100178912 366
101 3300031249 Ga0265339_10095153 Ga0265339_100951531 366
102 3300031344 Ga0265316_10019412 Ga0265316_100194123 366
103 3300031344 Ga0265316_10058814 Ga0265316_100588144 366
104 3300031344 Ga0265316_10086674 Ga0265316_100866742 366
105 3300031344 Ga0265316_10174270 Ga0265316_101742702 366
106 3300031711 Ga0265314_10000115 Ga0265314_1000011578 366
107 3300031711 Ga0265314_10100006 Ga0265314_101000062 366
108 3300031712 Ga0265342_10035808 Ga0265342_100358082 366
109 3300031712 Ga0265342_10070934 Ga0265342_100709342 366
110 3300032168 Ga0316593_10009964 Ga0316593_100099642 366
111 3300035118 Ga0373954_0013681 Ga0373954_0013681_1828_2928 366
112 3300035398 Ga0316574_0035765 Ga0316574_0035765_941_2041 366
113 3300035691 Ga0373931_0099323 Ga0373931_0099323_149_1249 366
114 3300035695 Ga0373927_0027308 Ga0373927_0027308_2314_3414 366
115 3300035725 Ga0373947_0037004 Ga0373947_0037004_815_1915 366
116 3300037068 Ga0373925_0002091 Ga0373925_0002091_5817_6917 366
117 3300037471 Ga0395905_0192408 Ga0395905_0192408_184_1284 366
118 3300037471 Ga0395905_0255431 Ga0395905_0255431_153_1253 366
119 3300039437 Ga0436365_1435552 Ga0436365_1435552_1314_2495 366
120 3300039450 Ga0436363_0568219 Ga0436363_0568219_2851_3951 366
121 3300041456 Ga0451795_0664674 Ga0451795_0664674_3707_4822 366
122 3300042876 Ga0451577_0000744 Ga0451577_0000744_17846_18946 366
123 3300042876 Ga0451577_0036929 Ga0451577_0036929_28_1137 366
124 3300042876 Ga0451577_0045089 Ga0451577_0045089_102_1208 366
125 3300042876 Ga0451577_0096387 Ga0451577_0096387_172_1287 366
126 3300044712 Ga0453684_0050876 Ga0453684_0050876_1968_3068 366
127 3300044712 Ga0453684_0170901 Ga0453684_0170901_134_1237 366
128 3300044712 Ga0453684_0326297 Ga0453684_0326297_277_1386 366
129 3300045051 Ga0451576_0058795 Ga0451576_0058795_965_2068 366
130 3300045051 Ga0451576_0147137 Ga0451576_0147137_95_1204 366
131 3300045051 Ga0451576_0188449 Ga0451576_0188449_449_1552 366
132 3300045051 Ga0451576_0265608 Ga0451576_0265608_355_1464 366
133 3300045051 Ga0451576_0283028 Ga0451576_0283028_535_1635 366
134 3300045051 Ga0451576_0545519 Ga0451576_0545519_37_1143 366
135 3300046454 Ga0495592_0000386 Ga0495592_0000386_18530_19633 366
136 3300046476 Ga0495662_0021040 Ga0495662_0021040_1294_2394 366
137 3300046477 Ga0495664_0016040 Ga0495664_0016040_2886_3989 366
138 3300046514 Ga0495618_0022384 Ga0495618_0022384_600_1703 366
139 3300046516 Ga0495628_0000208 Ga0495628_0000208_6993_8096 366
140 3300046516 Ga0495628_0175931 Ga0495628_0175931_234_1334 366
141 3300046517 Ga0495630_0000031 Ga0495630_0000031_131196_132296 366
142 3300046517 Ga0495630_0028955 Ga0495630_0028955_1996_3099 366
143 3300046526 Ga0495666_0004319 Ga0495666_0004319_5174_6277 366
144 3300046526 Ga0495666_0054024 Ga0495666_0054024_290_1390 366
145 3300046533 Ga0495640_0070398 Ga0495640_0070398_875_1975 366
146 3300046535 Ga0495586_0000016 Ga0495586_0000016_2789_3889 366
147 3300046535 Ga0495586_0000681 Ga0495586_0000681_7461_8564 366
148 3300046543 Ga0495645_0003416 Ga0495645_0003416_5360_6463 366
149 3300046642 Ga0495634_0053407 Ga0495634_0053407_1237_2337 366
150 3300046642 Ga0495634_0072833 Ga0495634_0072833_234_1334 366
151 3300046678 Ga0495599_0006549 Ga0495599_0006549_1718_2821 366
152 3300046683 Ga0495658_0068915 Ga0495658_0068915_50_1150 366
153 3300046689 Ga0495613_0052816 Ga0495613_0052816_721_1821 366
154 3300047319 Ga0495674_0007026 Ga0495674_0007026_2792_3892 366
155 3300047319 Ga0495674_0007679 Ga0495674_0007679_8590_9693 366
156 3300047321 Ga0495676_0002290 Ga0495676_0002290_6671_7771 366
157 3300047444 Ga0495675_0106727 Ga0495675_0106727_435_1535 366
158 3300047471 Ga0495684_0047774 Ga0495684_0047774_683_1783 366
159 3300048905 Ga0496102_0123201 Ga0496102_0123201_147_1265 366
160 3300048918 Ga0496115_0002091 Ga0496115_0002091_443_1570 366
161 3300053139 Ga0500568_0021054 Ga0500568_0021054_1500_2612 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

154

365

0.99

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

18

150

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eez-assembly1.cif.gz_F crystal structure of alanine dehydrogenase from themus thermophilus 0.981 1 365
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9797 1 365
2vhx-assembly1.cif.gz_C crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9793 1 365
2vhx-assembly1.cif.gz_D crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9763 1 365
8hye-assembly1.cif.gz_C-2 structure of amino acid dehydrogenase-2752 with ligand 0.9762 1 363
ID Description Score Start End Superfamily
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9993 3 113 3.40.50.720
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9891 3 109 3.40.50.720
af_Q2FYJ2_1_126_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9822 1 126 3.40.50.720
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9816 3 113 3.40.50.720
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9795 129 302 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V2RNS3-F1-model_v4 deleted 0.9989 1 133
AF-A0A1C5F701-F1-model_v4 L-alanine dehydrogenase 0.9983 1 116 GO:0000286
GO:0005886
GO:0006524
AF-A0A432IQF1-F1-model_v4 deleted 0.9982 1 116
AF-A0A3G9M6A5-F1-model_v4 deleted 0.9972 2 119
AF-A0A2M7GWY1-F1-model_v4 Alanine dehydrogenase 0.9971 1 110 GO:0000286
GO:0005886
GO:0006524

Feature Viewer

pLDDT pTM Quality
95.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map