F236919

General Info

Members Datasets Scaffolds Average Seq Length
161 113 322 397

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10087467|Ga0105248_100874673
Length 425
Sequence MPATSLEVPDQDLSSPPLAKAKVTLLPRKALPFYGRHPWVLASAVQKVEALGGKKLKEEKLDGEPVDLYNEKNKFVARGFYNSQSRIRVRLFTWSEGEALDESLFRRRIAQAILLRDQIGYEVVADRDQTATRLVFSEGDSLSGLVVDRYGDYLVVQATSMGIAKRLEMIVGILQDLLRPKGILLRADKSMAKLEGVEFTEEMHWGELPEGQLTIKENDIAFGLDLREGQKTGFYLDQRENRRAAAAYMKGRRVLDLFCYTGGFALAAAKLGGAKEVLGIDGSKKAIAQAEANAALNQLTNCKFEVADAFKTLDRLQGEGTRFEAVVLDPPKFARNRSTVNSALMAYHRVNRQAVDLLEPGGILVTNSCSGSVSREDFLLMLSGVAQKSGRDLQILEVRGAAADHPVSATCLETEYLKCVICRVS

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
44 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
45 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
46 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
47 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
48 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
49 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
50 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
51 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
52 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
53 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
54 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
60 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
61 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
62 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
63 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
72 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
73 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
77 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
78 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
92 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
93 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
96 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
97 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.11
Rhizosphere 96.27
Stem 0
Stem Tuber 0
Unclassified 10.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10087467 3300009177 Bacteria 3507
2 Ga0070689_100065730 3300005340 Bacteria 2825
3 Ga0070687_100002056 3300005343 Bacteria 7396
4 Ga0070671_100065756 3300005355 Unclassified 3021
5 Ga0070688_100001175 3300005365 Bacteria 13034
6 Ga0070688_100004917 3300005365 Bacteria 6991
7 Ga0070694_100017308 3300005444 Bacteria 4552
8 Ga0070694_100041636 3300005444 Bacteria 3065
9 Ga0070708_100009635 3300005445 Bacteria 7790
10 Ga0070708_100142693 3300005445 Bacteria 2222
11 Ga0070678_100031680 3300005456 Unclassified 3652
12 Ga0070685_10010940 3300005466 Bacteria 4732
13 Ga0070698_100048720 3300005471 Bacteria 4329
14 Ga0070699_100010104 3300005518 Bacteria 8171
15 Ga0070695_100004226 3300005545 Bacteria 8405
16 Ga0070704_100081457 3300005549 Bacteria 2384
17 Ga0068855_100358272 3300005563 Unclassified 1605
18 Ga0068863_100015178 3300005841 Bacteria 7400
19 Ga0068860_100013506 3300005843 Bacteria 8007
20 Ga0068860_100032087 3300005843 Bacteria 5049
21 Ga0068862_100230458 3300005844 Unclassified 1680
22 Ga0070717_10145311 3300006028 Bacteria 2048
23 Ga0097621_100233256 3300006237 Bacteria 1607
24 Ga0075428_100025656 3300006844 Bacteria 6526
25 Ga0075428_100103365 3300006844 Bacteria 3107
26 Ga0075433_10015685 3300006852 Bacteria 6223
27 Ga0075434_100017452 3300006871 Bacteria 6917
28 Ga0075434_100019709 3300006871 Bacteria 6529
29 Ga0075434_100167749 3300006871 Unclassified 2215
30 Ga0075436_100087870 3300006914 Bacteria 2159
31 Ga0075435_100009146 3300007076 Bacteria 7153
32 Ga0075435_100011996 3300007076 Bacteria 6403
33 Ga0075435_100014586 3300007076 Bacteria 5880
34 Ga0105240_10016027 3300009093 Bacteria 10161
35 Ga0111539_10285985 3300009094 Unclassified 1919
36 Ga0114129_10111363 3300009147 Bacteria 3777
37 Ga0105238_10000183 3300009551 Bacteria 68599
38 Ga0105249_10255177 3300009553 Bacteria 1740
39 Ga0157374_10109681 3300013296 Bacteria 2653
40 Ga0157378_10015123 3300013297 Bacteria 6757
41 Ga0163163_10002508 3300014325 Bacteria 15541
42 Ga0163163_10030979 3300014325 Bacteria 5158
43 Ga0163163_10070850 3300014325 Bacteria 3472
44 Ga0207695_10014053 3300025913 Bacteria 9506
45 Ga0207662_10002072 3300025918 Bacteria 9943
46 Ga0207694_10000225 3300025924 Bacteria 54907
47 Ga0207670_10000052 3300025936 Bacteria 86188
48 Ga0207641_10032045 3300026088 Bacteria 4363
49 Ga0207641_10145540 3300026088 Unclassified 2142
50 Ga0207676_10234679 3300026095 Unclassified 1642
51 Ga0207683_10011587 3300026121 Bacteria 7528
52 Ga0207428_10031899 3300027907 Unclassified 4339
53 Ga0268265_10141066 3300028380 Unclassified 2018
54 Ga0265338_10057891 3300028800 Bacteria 3425
55 Ga0316576_10002977 3300031727 Bacteria 9828
56 Ga0316576_10030782 3300031727 Bacteria 3803
57 Ga0316576_10066152 3300031727 Bacteria 2657
58 Ga0316576_10183106 3300031727 Bacteria 1580
59 Ga0373934_0004453 3300035086 Bacteria 5177
60 Ga0373923_0049468 3300035111 Bacteria 1758
61 Ga0373953_0011563 3300035117 Bacteria 3101
62 Ga0373957_0025226 3300035120 Bacteria 2140
63 Ga0373955_0022390 3300035172 Bacteria 3205
64 Ga0316574_0011393 3300035398 Bacteria 5051
65 Ga0316574_0011909 3300035398 Bacteria 4958
66 Ga0373933_0062397 3300035724 Bacteria 2250
67 Ga0373937_0012745 3300036401 Bacteria 7400
68 Ga0373937_0140085 3300036401 Bacteria 2262
69 Ga0316582_0014223 3300036647 Bacteria 4509
70 Ga0316584_0011837 3300036712 Bacteria 6144
71 Ga0316584_0118618 3300036712 Bacteria 1978
72 Ga0436365_0290070 3300039437 Bacteria 5179
73 Ga0436361_0781845 3300039447 Bacteria 1429
74 Ga0439431_0018451 3300041997 Bacteria 1651
75 Ga0451577_0001276 3300042876 Bacteria 34675
76 Ga0451577_0001783 3300042876 Bacteria 27612
77 Ga0451577_0136766 3300042876 Bacteria 2200
78 Ga0453683_0002418 3300044673 Bacteria 14516
79 Ga0453683_0003773 3300044673 Bacteria 11042
80 Ga0453683_0016002 3300044673 Bacteria 4846
81 Ga0453683_0017375 3300044673 Bacteria 4631
82 Ga0453684_0001112 3300044712 Bacteria 84448
83 Ga0453684_0012214 3300044712 Bacteria 14228
84 Ga0453684_0070582 3300044712 Bacteria 4423
85 Ga0453684_0104735 3300044712 Bacteria 3453
86 Ga0453684_0136202 3300044712 Bacteria 2940
87 Ga0453684_0195228 3300044712 Unclassified 2365
88 Ga0453684_0309636 3300044712 Bacteria 1792
89 Ga0451576_0000226 3300045051 Bacteria 138181
90 Ga0451576_0075770 3300045051 Bacteria 3501
91 Ga0451576_0089208 3300045051 Bacteria 3207
92 Ga0451576_0102565 3300045051 Bacteria 2976
93 Ga0451576_0107382 3300045051 Unclassified 2904
94 Ga0451576_0116146 3300045051 Bacteria 2786
95 Ga0451576_0149795 3300045051 Bacteria 2433
96 Ga0451576_0354798 3300045051 Bacteria 1535
97 Ga0495592_0047081 3300046454 Bacteria 3212
98 Ga0495603_0016627 3300046455 Bacteria 4452
99 Ga0495653_0082011 3300046463 Bacteria 2382
100 Ga0495580_0131968 3300046472 Bacteria 1732
101 Ga0495608_0016991 3300046511 Bacteria 5033
102 Ga0495618_0001000 3300046514 Bacteria 19344
103 Ga0495628_0056684 3300046516 Bacteria 3083
104 Ga0495587_0013441 3300046536 Bacteria 5145
105 Ga0495667_0034278 3300046559 Bacteria 3394
106 Ga0495634_0041998 3300046642 Bacteria 3104
107 Ga0495599_0031610 3300046678 Bacteria 3322
108 Ga0495581_0041999 3300047315 Bacteria 2647
109 Ga0495604_0035532 3300047317 Bacteria 3936
110 Ga0495675_0013491 3300047444 Bacteria 5158
111 Ga0496100_0153416 3300048903 Bacteria 1645
112 Ga0496104_0286509 3300048907 Bacteria 1560
113 Ga0496109_0016738 3300048912 Bacteria 6415
114 Ga0496112_0014132 3300048915 Bacteria 7394
115 Ga0496113_0089898 3300048916 Bacteria 2364
116 Ga0501031_0067993 3300049568 Unclassified 2320
117 Ga0501032_0004039 3300049569 Bacteria 11129
118 Ga0501033_0012336 3300049570 Bacteria 6522
119 Ga0501033_0017081 3300049570 Bacteria 5484
120 Ga0501034_0002662 3300049571 Bacteria 21124
121 Ga0501034_0011068 3300049571 Bacteria 9369
122 Ga0501034_0021228 3300049571 Bacteria 6623
123 Ga0501034_0034514 3300049571 Bacteria 5128
124 Ga0501034_0228349 3300049571 Bacteria 1811
125 Ga0501036_0000211 3300049572 Bacteria 39073
126 Ga0501037_0002155 3300049573 Bacteria 14253
127 Ga0501039_0035619 3300049575 Bacteria 3841
128 Ga0501043_0001786 3300049579 Bacteria 18490
129 Ga0501043_0244616 3300049579 Bacteria 1383
130 Ga0501046_0008734 3300049580 Bacteria 8802
131 Ga0501046_0019906 3300049580 Bacteria 5558
132 Ga0501047_0022885 3300049581 Bacteria 5999
133 Ga0501048_0013150 3300049582 Bacteria 6144
134 Ga0501067_0001540 3300049583 Bacteria 12565
135 Ga0501068_0000846 3300049584 Bacteria 15936
136 Ga0501069_0069371 3300049585 Unclassified 1973
137 Ga0501070_0015734 3300049586 Bacteria 6361
138 Ga0501072_0002333 3300049588 Bacteria 14236
139 Ga0501073_0018936 3300049589 Bacteria 4974
140 Ga0501074_0006116 3300049590 Bacteria 8693
141 Ga0501079_0025197 3300049741 Bacteria 4562
142 Ga0501080_0000193 3300049742 Bacteria 44520
143 Ga0501083_0032791 3300049744 Unclassified 3559
144 Ga0501035_0001322 3300049822 Bacteria 25575
145 Ga0501035_0023630 3300049822 Bacteria 5640
146 Ga0501044_0018596 3300049823 Bacteria 7445
147 Ga0501045_0056692 3300049824 Bacteria 2866
148 nmdc:mga09592_49_c2 3300050508 Bacteria 10715
149 nmdc:mga06r32_266324_c1 3300050510 Bacteria 1701
150 nmdc:mga08y16_208725_c1 3300050511 Bacteria 2023
151 nmdc:mga0n895_4866_c1 3300050512 Bacteria 11128
152 nmdc:mga0n895_52161_c1 3300050512 Bacteria 4014
153 nmdc:mga0rr50_10119_c1 3300050513 Bacteria 5968
154 nmdc:mga0rr50_21325_c1 3300050513 Bacteria 4420
155 nmdc:mga0rr50_64673_c1 3300050513 Bacteria 2768
156 nmdc:mga08x19_120402_c1 3300050514 Unclassified 1759
157 nmdc:mga08x19_53464_c1 3300050514 Bacteria 2599
158 nmdc:mga0a205_145637_c1 3300050515 Unclassified 2269
159 Ga0495595_0108471 3300053084 Bacteria 1344
160 Ga0501084_0000483 3300054114 Bacteria 30467
161 Ga0501082_0008135 3300060353 Bacteria 9048
162 Ga0105248_10087467
163 Ga0070689_100065730
164 Ga0070687_100002056
165 Ga0070671_100065756
166 Ga0070688_100001175
167 Ga0070688_100004917
168 Ga0070694_100017308
169 Ga0070694_100041636
170 Ga0070708_100009635
171 Ga0070708_100142693
172 Ga0070678_100031680
173 Ga0070685_10010940
174 Ga0070698_100048720
175 Ga0070699_100010104
176 Ga0070695_100004226
177 Ga0070704_100081457
178 Ga0068855_100358272
179 Ga0068863_100015178
180 Ga0068860_100013506
181 Ga0068860_100032087
182 Ga0068862_100230458
183 Ga0070717_10145311
184 Ga0097621_100233256
185 Ga0075428_100025656
186 Ga0075428_100103365
187 Ga0075433_10015685
188 Ga0075434_100017452
189 Ga0075434_100019709
190 Ga0075434_100167749
191 Ga0075436_100087870
192 Ga0075435_100009146
193 Ga0075435_100011996
194 Ga0075435_100014586
195 Ga0105240_10016027
196 Ga0111539_10285985
197 Ga0114129_10111363
198 Ga0105238_10000183
199 Ga0105249_10255177
200 Ga0157374_10109681
201 Ga0157378_10015123
202 Ga0163163_10002508
203 Ga0163163_10030979
204 Ga0163163_10070850
205 Ga0207695_10014053
206 Ga0207662_10002072
207 Ga0207694_10000225
208 Ga0207670_10000052
209 Ga0207641_10032045
210 Ga0207641_10145540
211 Ga0207676_10234679
212 Ga0207683_10011587
213 Ga0207428_10031899
214 Ga0268265_10141066
215 Ga0265338_10057891
216 Ga0316576_10002977
217 Ga0316576_10030782
218 Ga0316576_10066152
219 Ga0316576_10183106
220 Ga0373934_0004453
221 Ga0373923_0049468
222 Ga0373953_0011563
223 Ga0373957_0025226
224 Ga0373955_0022390
225 Ga0316574_0011393
226 Ga0316574_0011909
227 Ga0373933_0062397
228 Ga0373937_0012745
229 Ga0373937_0140085
230 Ga0316582_0014223
231 Ga0316584_0011837
232 Ga0316584_0118618
233 Ga0436365_0290070
234 Ga0436361_0781845
235 Ga0439431_0018451
236 Ga0451577_0001276
237 Ga0451577_0001783
238 Ga0451577_0136766
239 Ga0453683_0002418
240 Ga0453683_0003773
241 Ga0453683_0016002
242 Ga0453683_0017375
243 Ga0453684_0001112
244 Ga0453684_0012214
245 Ga0453684_0070582
246 Ga0453684_0104735
247 Ga0453684_0136202
248 Ga0453684_0195228
249 Ga0453684_0309636
250 Ga0451576_0000226
251 Ga0451576_0075770
252 Ga0451576_0089208
253 Ga0451576_0102565
254 Ga0451576_0107382
255 Ga0451576_0116146
256 Ga0451576_0149795
257 Ga0451576_0354798
258 Ga0495592_0047081
259 Ga0495603_0016627
260 Ga0495653_0082011
261 Ga0495580_0131968
262 Ga0495608_0016991
263 Ga0495618_0001000
264 Ga0495628_0056684
265 Ga0495587_0013441
266 Ga0495667_0034278
267 Ga0495634_0041998
268 Ga0495599_0031610
269 Ga0495581_0041999
270 Ga0495604_0035532
271 Ga0495675_0013491
272 Ga0496100_0153416
273 Ga0496104_0286509
274 Ga0496109_0016738
275 Ga0496112_0014132
276 Ga0496113_0089898
277 Ga0501031_0067993
278 Ga0501032_0004039
279 Ga0501033_0012336
280 Ga0501033_0017081
281 Ga0501034_0002662
282 Ga0501034_0011068
283 Ga0501034_0021228
284 Ga0501034_0034514
285 Ga0501034_0228349
286 Ga0501036_0000211
287 Ga0501037_0002155
288 Ga0501039_0035619
289 Ga0501043_0001786
290 Ga0501043_0244616
291 Ga0501046_0008734
292 Ga0501046_0019906
293 Ga0501047_0022885
294 Ga0501048_0013150
295 Ga0501067_0001540
296 Ga0501068_0000846
297 Ga0501069_0069371
298 Ga0501070_0015734
299 Ga0501072_0002333
300 Ga0501073_0018936
301 Ga0501074_0006116
302 Ga0501079_0025197
303 Ga0501080_0000193
304 Ga0501083_0032791
305 Ga0501035_0001322
306 Ga0501035_0023630
307 Ga0501044_0018596
308 Ga0501045_0056692
309 nmdc:mga09592_49_c2
310 nmdc:mga06r32_266324_c1
311 nmdc:mga08y16_208725_c1
312 nmdc:mga0n895_4866_c1
313 nmdc:mga0n895_52161_c1
314 nmdc:mga0rr50_10119_c1
315 nmdc:mga0rr50_21325_c1
316 nmdc:mga0rr50_64673_c1
317 nmdc:mga08x19_120402_c1
318 nmdc:mga08x19_53464_c1
319 nmdc:mga0a205_145637_c1
320 Ga0495595_0108471
321 Ga0501084_0000483
322 Ga0501082_0008135

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17785

PUA_3

PUA-like domain

23

94

0.93

PF10672

Methyltrans_SAM

S-adenosylmethionine-dependent methyltransferase

196

398

0.87

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

236

327

0.86

PF03602

Cons_hypoth95

Conserved hypothetical protein 95

242

371

0.84

PF05175

MTS

Methyltransferase small domain

243

375

0.84

PF13847

Methyltransf_31

Methyltransferase domain

249

400

0.84

PF13649

Methyltransf_25

Methyltransferase domain

254

362

0.81

PF02475

Met_10

Met-10+ like-protein

148

336

0.78

PF01728

FtsJ

FtsJ-like methyltransferase

236

388

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c0k-assembly1.cif.gz_B crystal structure of a ribosomal rna methyltranferase 0.9663 7 396
4dmg-assembly1.cif.gz_B thermus thermophilus m5c1942 methyltransferase rlmo 0.9592 7 396
2as0-assembly1.cif.gz_B crystal structure of ph1915 (apc 5817): a hypothetical rna methyltransferase 0.9562 7 395
3c0k-assembly1.cif.gz_B crystal structure of a ribosomal rna methyltranferase 0.952 7 396
2cww-assembly1.cif.gz_A-2 crystal structure of thermus thermophilus ttha1280, a putative sam-dependent rna methyltransferase, in complex with s-adenosyl-l-homocysteine 0.9478 9 396
ID Description Score Start End Superfamily
af_Q8IKX0_132_231_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.9844 77 176 3.30.750.80
af_Q8IKX0_132_231_3.30.750.80 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;RNA methyltransferase domain (HRMD) like 0.9748 77 176 3.30.750.80
af_I1KW47_231_444_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9707 184 396 3.40.50.150
af_A0A1D6H1M4_236_424_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.968 221 394 3.40.50.150
af_I1KW47_231_444_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9619 184 396 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3N5X649-F1-model_v4 Methyltransferase domain-containing protein 0.9953 226 396 GO:0005737
GO:0008168
GO:0032259
AF-A0A4Q3QVV2-F1-model_v4 deleted 0.9952 300 396
AF-A0A2M8NY51-F1-model_v4 23S rRNA (Cytosine(1962)-C(5))-methyltransferase RlmI 0.9933 278 396 GO:0005737
GO:0008168
GO:0032259
AF-A0A644XYV4-F1-model_v4 Ribosomal RNA large subunit methyltransferase I (EC 2.1.1.191) 0.9906 226 396 GO:0005737
GO:0008168
GO:0032259
AF-A0A376UC78-F1-model_v4 Putative oxidoreductase (EC 2.1.1.191) 0.9884 226 396 GO:0003723
GO:0005737
GO:0006364
GO:0008168
GO:0032259

Map