F236806

General Info

Members Datasets Scaffolds Average Seq Length
161 121 144 247

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10000200|Ga0105240_1000020019
Length 294
Sequence MTVPRAIKITNIEFQTPKYLLAPVYFIIRNPVFDIIVLWRNICRPHFMPEGPIIIILKEELQQFKHKEVIAANGYTPNLDPDILIGQKLIDIKSWGKHLLLCFPKFTVRVHLMLFGSWRINSRGKKNASLGLEFPNGEVNFYISSIVLIETPLDEVYDWQADVMSDEWDTEKTIEKLKQKPKAFIGDVLLDQKIFSGVGNIIRNEAMFRARIHPQSMVGAIPDKKLHQLINETVKYSFDFLKWKKERVLSRHFEAYEQEMCPRDHIPFQKADLGKTKRHTYYCDVCEVLYDGDD

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
4 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
5 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
6 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
7 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
8 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
9 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
10 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
11 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
12 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
13 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
14 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
15 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
47 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
49 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
50 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
66 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
88 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
89 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
90 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
91 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
92 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
95 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
110 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
111 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
112 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
117 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
118 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
119 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
120 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
121 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.44
Metatranscriptomes 0
Isolates 10.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.8
Nodule 0.62
Rhizoplane 1.86
Rhizosphere 70.19
Stem 0
Stem Tuber 0
Unclassified 15.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1002227 3300002737 Bacteria 7948
2 JGI25164J39214_1002201 3300002772 Unclassified 3220
3 JGI25165J46597_1001779 3300003214 Bacteria 9291
4 rootH2_10025204 3300003320 Bacteria 5707
5 rootH2_10080829 3300003320 Bacteria 7685
6 rootH2_10103073 3300003320 Bacteria 7985
7 rootL2_10148286 3300003322 Bacteria 2911
8 rootH1_10004761 3300003323 Bacteria 43462
9 Ga0055536_1000609 3300003781 Bacteria 24373
10 Ga0065714_10005839 3300005288 Bacteria 15749
11 Ga0065714_10067092 3300005288 Bacteria 5881
12 Ga0065715_10218888 3300005293 Bacteria 1281
13 Ga0070682_100000044 3300005337 Bacteria 133653
14 Ga0070661_100098788 3300005344 Bacteria 2168
15 Ga0068853_100048967 3300005539 Bacteria 3630
16 Ga0068853_100089711 3300005539 Bacteria 2700
17 Ga0068855_100032295 3300005563 Bacteria 6251
18 Ga0068855_100217497 3300005563 Bacteria 2144
19 Ga0068854_100111601 3300005578 Bacteria 2063
20 Ga0068856_100008821 3300005614 Bacteria 9812
21 Ga0068856_100014774 3300005614 Bacteria 7537
22 Ga0068856_100024648 3300005614 Bacteria 5857
23 Ga0068852_100243246 3300005616 Bacteria 1721
24 Ga0075363_100257533 3300006048 Bacteria 1006
25 Ga0075362_10160734 3300006177 Bacteria 1081
26 Ga0075367_10033772 3300006178 Bacteria 2951
27 Ga0075429_100456739 3300006880 Unclassified 1119
28 Ga0105244_10000004 3300009036 Bacteria 492478
29 Ga0105240_10000200 3300009093 Bacteria 121941
30 Ga0105240_10424712 3300009093 Bacteria 1492
31 Ga0114129_10678875 3300009147 Unclassified 1326
32 Ga0105241_10013306 3300009174 Bacteria 6030
33 Ga0105241_10096483 3300009174 Bacteria 2342
34 Ga0105241_10323079 3300009174 Bacteria 1331
35 Ga0105237_10000239 3300009545 Bacteria 78319
36 Ga0105237_10047678 3300009545 Bacteria 4306
37 Ga0105237_10051994 3300009545 Bacteria 4114
38 Ga0105237_10068213 3300009545 Unclassified 3551
39 Ga0105238_10000774 3300009551 Bacteria 33230
40 Ga0105238_10202909 3300009551 Bacteria 1959
41 Ga0105239_10000006 3300010375 Bacteria 442319
42 Ga0105239_10000162 3300010375 Bacteria 95804
43 Ga0105239_10001646 3300010375 Bacteria 29459
44 Ga0105239_10233026 3300010375 Bacteria 2066
45 Ga0157370_10038586 3300013104 Bacteria 4620
46 Ga0157370_10728340 3300013104 Bacteria 904
47 Ga0157369_10000898 3300013105 Bacteria 37983
48 Ga0157372_10000971 3300013307 Bacteria 31279
49 Ga0157372_10283143 3300013307 Bacteria 1927
50 Ga0182005_1001026 3300015265 Bacteria 11852
51 Ga0209563_104008 3300025230 Bacteria 2902
52 Ga0207427_100110 3300025231 Bacteria 113735
53 Ga0209437_100093 3300025233 Bacteria 239733
54 Ga0209233_1000089 3300025261 Bacteria 316381
55 Ga0207426_1004420 3300025302 Bacteria 6866
56 Ga0207655_1000008 3300025728 Bacteria 734289
57 Ga0207705_10000118 3300025909 Bacteria 88199
58 Ga0207654_10254869 3300025911 Bacteria 1178
59 Ga0207695_10000055 3300025913 Bacteria 382776
60 Ga0207695_10000271 3300025913 Bacteria 129900
61 Ga0207695_10455453 3300025913 Bacteria 1162
62 Ga0207695_10482066 3300025913 Bacteria 1122
63 Ga0207671_10005503 3300025914 Bacteria 11654
64 Ga0207671_10008026 3300025914 Bacteria 9031
65 Ga0207671_10012393 3300025914 Bacteria 6859
66 Ga0207671_10069093 3300025914 Unclassified 2633
67 Ga0207657_10055672 3300025919 Bacteria 3416
68 Ga0207649_10017824 3300025920 Bacteria 4028
69 Ga0207694_10027915 3300025924 Bacteria 4302
70 Ga0207694_10137404 3300025924 Bacteria 1964
71 Ga0207667_10197262 3300025949 Bacteria 2065
72 Ga0207640_10032704 3300025981 Bacteria 3227
73 Ga0207639_10000297 3300026041 Bacteria 35342
74 Ga0207702_10007433 3300026078 Bacteria 9349
75 Ga0207702_10035866 3300026078 Bacteria 4147
76 Ga0207702_10217695 3300026078 Bacteria 1778
77 Ga0207674_10321113 3300026116 Bacteria 1498
78 Ga0209281_1000116 3300027111 Bacteria 209707
79 Ga0209969_1006184 3300027360 Bacteria 1684
80 Ga0209996_1001533 3300027395 Bacteria 2804
81 Ga0209984_1021035 3300027424 Bacteria 893
82 Ga0209983_1001300 3300027665 Bacteria 5562
83 Ga0209971_1000958 3300027682 Bacteria 7413
84 Ga0209974_10012612 3300027876 Bacteria 2823
85 Ga0307515_10000135 3300028794 Bacteria 175323
86 Ga0307515_10015728 3300028794 Bacteria 13920
87 Ga0316179_1032275 3300030734 Bacteria 2345
88 Ga0307513_10060904 3300031456 Bacteria 3999
89 Ga0307408_100021074 3300031548 Bacteria 4407
90 Ga0307408_100030080 3300031548 Bacteria 3769
91 Ga0307516_10003103 3300031730 Bacteria 21610
92 Ga0307405_10091142 3300031731 Bacteria 2019
93 Ga0307410_10020501 3300031852 Bacteria 4044
94 Ga0307406_10006519 3300031901 Bacteria 6449
95 Ga0307414_10000001 3300032004 Bacteria 1352954
96 Ga0307411_10000013 3300032005 Bacteria 145335
97 Ga0395899_0021300 3300037312 Bacteria 4917
98 Ga0395899_0061877 3300037312 Bacteria 2756
99 Ga0395899_0076405 3300037312 Bacteria 2445
100 Ga0395900_0011787 3300037418 Bacteria 8939
101 Ga0395900_0107324 3300037418 Bacteria 2868
102 Ga0395898_0011322 3300037466 Bacteria 9273
103 Ga0395898_0113122 3300037466 Bacteria 2601
104 Ga0395905_0038714 3300037471 Bacteria 4473
105 Ga0395901_0002260 3300038443 Bacteria 19658
106 Ga0395901_0063237 3300038443 Bacteria 3851
107 Ga0439447_000675 3300041407 Bacteria 12660
108 Ga0439466_0007494 3300041411 Bacteria 4129
109 Ga0439466_0029852 3300041411 Bacteria 1874
110 Ga0451791_0456701 3300041451 Bacteria 1799
111 Ga0451802_1029125 3300041460 Bacteria 2239
112 Ga0451807_0779411 3300041486 Bacteria 1223
113 Ga0451841_0503555 3300041498 Bacteria 2760
114 Ga0451853_1804841 3300041512 Bacteria 2283
115 Ga0439431_0000444 3300041997 Bacteria 8719
116 Ga0439445_0025061 3300042004 Bacteria 1520
117 Ga0453683_0057436 3300044673 Bacteria 2434
118 Ga0495620_0117931 3300046515 Bacteria 1048
119 Ga0495632_0037959 3300046519 Bacteria 2440
120 Ga0495625_0001712 3300046660 Bacteria 25517
121 Ga0495686_0110012 3300047472 Bacteria 1653
122 Ga0496121_0000011 3300048924 Bacteria 792193
123 Ga0496121_0012223 3300048924 Bacteria 9406
124 Ga0501032_0205671 3300049569 Bacteria 1284
125 Ga0501034_0021492 3300049571 Bacteria 6578
126 Ga0501034_0638507 3300049571 Bacteria 967
127 Ga0501037_0077575 3300049573 Bacteria 2411
128 Ga0501043_0025414 3300049579 Bacteria 4647
129 Ga0501046_0327667 3300049580 Bacteria 1115
130 Ga0501046_0360217 3300049580 Bacteria 1055
131 Ga0501047_0008969 3300049581 Bacteria 9442
132 Ga0501070_0709914 3300049586 Bacteria 795
133 Ga0501238_000114 3300049671 Bacteria 12607
134 Ga0501249_010700 3300049679 Bacteria 1921
135 Ga0501241_000647 3300049758 Bacteria 7478
136 Ga0501266_000005 3300049763 Bacteria 346750
137 Ga0501044_0048416 3300049823 Bacteria 4391
138 nmdc:mga03n38_209185_c1 3300050490 Bacteria 1013
139 nmdc:mga0k408_9422_c1 3300050493 Bacteria 5261
140 Ga0500635_0008099 3300053080 Bacteria 2871
141 Ga0500642_0041731 3300053130 Bacteria 1985
142 Ga0500658_0000021 3300053134 Bacteria 133042
143 Ga0500658_0031538 3300053134 Bacteria 2073
144 Ga0500587_007831 3300053739 Bacteria 1382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0107324 Ga0395900_0107324_2231_2848 203
2 3300037466 Ga0395898_0113122 Ga0395898_0113122_21_638 203
3 3300038443 Ga0395901_0063237 Ga0395901_0063237_3214_3831 203
4 3300049586 Ga0501070_0709914 Ga0501070_0709914_138_779 211
5 3300013307 Ga0157372_10283143 Ga0157372_102831432 221
6 3300015265 Ga0182005_1001026 Ga0182005_10010266 224
7 3300027395 Ga0209996_1001533 Ga0209996_10015335 228
8 3300027665 Ga0209983_1001300 Ga0209983_10013003 228
9 3300027682 Ga0209971_1000958 Ga0209971_10009586 228
10 3300027876 Ga0209974_10012612 Ga0209974_100126122 228
11 iso_pu_bacteria 2585428062 2587758025 239
12 iso_pu_bacteria 2643221577 2643895358 239
13 iso_pu_bacteria 2643221600 2644011392 239
14 iso_pu_bacteria 2643221667 2644369801 239
15 iso_pu_bacteria 2643221685 2644477528 239
16 iso_pu_bacteria 2643221716 2644642356 239
17 iso_pu_bacteria 2728369097 2729145644 239
18 iso_pu_bacteria 2818991442 2819577557 239
19 iso_pu_bacteria 2821136567 2821142269 239
20 iso_pu_bacteria 2857613821 2857614595 239
21 iso_pu_bacteria 2857618242 2857619006 239
22 iso_pu_bacteria 2904419702 2904419884 239
23 iso_pu_bacteria 2904467357 2904470565 239
24 iso_pu_bacteria 2904555929 2904556678 239
25 iso_pu_bacteria 2929150217 2929153104 239
26 iso_pu_bacteria 651053060 651174670 239
27 3300003322 rootL2_10148286 rootL2_101482864 242
28 3300049758 Ga0501241_000647 Ga0501241_000647_3455_4183 242
29 3300003781 Ga0055536_1000609 Ga0055536_100060922 243
30 3300005288 Ga0065714_10005839 Ga0065714_100058396 243
31 3300005288 Ga0065714_10067092 Ga0065714_100670921 243
32 3300005293 Ga0065715_10218888 Ga0065715_102188881 243
33 3300005337 Ga0070682_100000044 Ga0070682_100000044128 243
34 3300005344 Ga0070661_100098788 Ga0070661_1000987883 243
35 3300005539 Ga0068853_100048967 Ga0068853_1000489671 243
36 3300005563 Ga0068855_100217497 Ga0068855_1002174973 243
37 3300005578 Ga0068854_100111601 Ga0068854_1001116012 243
38 3300005614 Ga0068856_100024648 Ga0068856_1000246483 243
39 3300005616 Ga0068852_100243246 Ga0068852_1002432461 243
40 3300006048 Ga0075363_100257533 Ga0075363_1002575332 243
41 3300006177 Ga0075362_10160734 Ga0075362_101607342 243
42 3300006178 Ga0075367_10033772 Ga0075367_100337722 243
43 3300009036 Ga0105244_10000004 Ga0105244_10000004306 243
44 3300009174 Ga0105241_10013306 Ga0105241_100133066 243
45 3300009545 Ga0105237_10047678 Ga0105237_100476786 243
46 3300009551 Ga0105238_10000774 Ga0105238_1000077420 243
47 3300013104 Ga0157370_10038586 Ga0157370_100385862 243
48 3300013105 Ga0157369_10000898 Ga0157369_1000089831 243
49 3300013307 Ga0157372_10000971 Ga0157372_1000097120 243
50 3300025302 Ga0207426_1004420 Ga0207426_10044205 243
51 3300025728 Ga0207655_1000008 Ga0207655_1000008282 243
52 3300025911 Ga0207654_10254869 Ga0207654_102548692 243
53 3300025913 Ga0207695_10000271 Ga0207695_1000027131 243
54 3300025914 Ga0207671_10012393 Ga0207671_100123932 243
55 3300025920 Ga0207649_10017824 Ga0207649_100178244 243
56 3300025924 Ga0207694_10027915 Ga0207694_100279154 243
57 3300025949 Ga0207667_10197262 Ga0207667_101972623 243
58 3300025981 Ga0207640_10032704 Ga0207640_100327043 243
59 3300026041 Ga0207639_10000297 Ga0207639_1000029717 243
60 3300026078 Ga0207702_10007433 Ga0207702_100074332 243
61 3300026078 Ga0207702_10035866 Ga0207702_100358662 243
62 3300026116 Ga0207674_10321113 Ga0207674_103211132 243
63 3300027111 Ga0209281_1000116 Ga0209281_1000116146 243
64 3300027360 Ga0209969_1006184 Ga0209969_10061841 243
65 3300027424 Ga0209984_1021035 Ga0209984_10210351 243
66 3300028794 Ga0307515_10015728 Ga0307515_100157286 243
67 3300030734 Ga0316179_1032275 Ga0316179_10322753 243
68 3300031456 Ga0307513_10060904 Ga0307513_100609042 243
69 3300031548 Ga0307408_100030080 Ga0307408_1000300801 243
70 3300031730 Ga0307516_10003103 Ga0307516_1000310321 243
71 3300031731 Ga0307405_10091142 Ga0307405_100911422 243
72 3300031852 Ga0307410_10020501 Ga0307410_100205011 243
73 3300031901 Ga0307406_10006519 Ga0307406_100065195 243
74 3300032004 Ga0307414_10000001 Ga0307414_10000001831 243
75 3300032005 Ga0307411_10000013 Ga0307411_100000132 243
76 3300037312 Ga0395899_0021300 Ga0395899_0021300_967_1704 243
77 3300037312 Ga0395899_0061877 Ga0395899_0061877_1374_2111 243
78 3300037312 Ga0395899_0076405 Ga0395899_0076405_208_945 243
79 3300037418 Ga0395900_0011787 Ga0395900_0011787_6374_7111 243
80 3300037466 Ga0395898_0011322 Ga0395898_0011322_1460_2197 243
81 3300037471 Ga0395905_0038714 Ga0395905_0038714_432_1169 243
82 3300038443 Ga0395901_0002260 Ga0395901_0002260_11778_12515 243
83 3300041407 Ga0439447_000675 Ga0439447_000675_3458_4189 243
84 3300041411 Ga0439466_0007494 Ga0439466_0007494_1541_2272 243
85 3300041411 Ga0439466_0029852 Ga0439466_0029852_931_1662 243
86 3300041451 Ga0451791_0456701 Ga0451791_0456701_905_1636 243
87 3300041460 Ga0451802_1029125 Ga0451802_1029125_398_1150 243
88 3300041486 Ga0451807_0779411 Ga0451807_0779411_289_1041 243
89 3300041498 Ga0451841_0503555 Ga0451841_0503555_994_1734 243
90 3300041512 Ga0451853_1804841 Ga0451853_1804841_960_1712 243
91 3300041997 Ga0439431_0000444 Ga0439431_0000444_1224_1955 243
92 3300042004 Ga0439445_0025061 Ga0439445_0025061_320_1051 243
93 3300044673 Ga0453683_0057436 Ga0453683_0057436_450_1205 243
94 3300046515 Ga0495620_0117931 Ga0495620_0117931_281_1033 243
95 3300046519 Ga0495632_0037959 Ga0495632_0037959_53_805 243
96 3300046660 Ga0495625_0001712 Ga0495625_0001712_7846_8598 243
97 3300047472 Ga0495686_0110012 Ga0495686_0110012_633_1385 243
98 3300048924 Ga0496121_0000011 Ga0496121_0000011_136641_137372 243
99 3300048924 Ga0496121_0012223 Ga0496121_0012223_1704_2435 243
100 3300049569 Ga0501032_0205671 Ga0501032_0205671_229_966 243
101 3300049571 Ga0501034_0021492 Ga0501034_0021492_5035_5766 243
102 3300049571 Ga0501034_0638507 Ga0501034_0638507_147_884 243
103 3300049573 Ga0501037_0077575 Ga0501037_0077575_149_886 243
104 3300049579 Ga0501043_0025414 Ga0501043_0025414_330_1067 243
105 3300049580 Ga0501046_0327667 Ga0501046_0327667_114_848 243
106 3300049580 Ga0501046_0360217 Ga0501046_0360217_138_875 243
107 3300049581 Ga0501047_0008969 Ga0501047_0008969_8612_9349 243
108 3300049671 Ga0501238_000114 Ga0501238_000114_4629_5360 243
109 3300049679 Ga0501249_010700 Ga0501249_010700_668_1399 243
110 3300049763 Ga0501266_000005 Ga0501266_000005_96699_97430 243
111 3300049823 Ga0501044_0048416 Ga0501044_0048416_748_1485 243
112 3300050490 nmdc:mga03n38_209185_c1 nmdc:mga03n38_209185_c1_147_899 243
113 3300053134 Ga0500658_0000021 Ga0500658_0000021_58355_59086 243
114 3300053134 Ga0500658_0031538 Ga0500658_0031538_25_777 243
115 3300053739 Ga0500587_007831 Ga0500587_007831_288_1040 243
116 iso_pu_bacteria 640427133 640486816 243
117 3300002737 JGI25162J39368_1002227 JGI25162J39368_10022275 244
118 3300002772 JGI25164J39214_1002201 JGI25164J39214_10022013 244
119 3300003214 JGI25165J46597_1001779 JGI25165J46597_10017797 244
120 3300003320 rootH2_10025204 rootH2_100252044 244
121 3300003320 rootH2_10080829 rootH2_100808295 244
122 3300003320 rootH2_10103073 rootH2_101030737 244
123 3300003323 rootH1_10004761 rootH1_1000476122 244
124 3300005539 Ga0068853_100089711 Ga0068853_1000897114 244
125 3300005563 Ga0068855_100032295 Ga0068855_1000322958 244
126 3300005614 Ga0068856_100008821 Ga0068856_1000088216 244
127 3300005614 Ga0068856_100014774 Ga0068856_1000147747 244
128 3300006880 Ga0075429_100456739 Ga0075429_1004567391 244
129 3300009093 Ga0105240_10000200 Ga0105240_1000020019 244
130 3300009093 Ga0105240_10424712 Ga0105240_104247122 244
131 3300009147 Ga0114129_10678875 Ga0114129_106788752 244
132 3300009174 Ga0105241_10096483 Ga0105241_100964832 244
133 3300009174 Ga0105241_10323079 Ga0105241_103230791 244
134 3300009545 Ga0105237_10000239 Ga0105237_1000023937 244
135 3300009545 Ga0105237_10051994 Ga0105237_100519943 244
136 3300009545 Ga0105237_10068213 Ga0105237_100682134 244
137 3300009551 Ga0105238_10202909 Ga0105238_102029092 244
138 3300010375 Ga0105239_10000006 Ga0105239_10000006393 244
139 3300010375 Ga0105239_10000162 Ga0105239_1000016244 244
140 3300010375 Ga0105239_10001646 Ga0105239_1000164616 244
141 3300010375 Ga0105239_10233026 Ga0105239_102330261 244
142 3300013104 Ga0157370_10728340 Ga0157370_107283401 244
143 3300025230 Ga0209563_104008 Ga0209563_1040082 244
144 3300025231 Ga0207427_100110 Ga0207427_10011084 244
145 3300025233 Ga0209437_100093 Ga0209437_100093129 244
146 3300025261 Ga0209233_1000089 Ga0209233_1000089206 244
147 3300025909 Ga0207705_10000118 Ga0207705_1000011817 244
148 3300025913 Ga0207695_10000055 Ga0207695_1000005519 244
149 3300025913 Ga0207695_10455453 Ga0207695_104554532 244
150 3300025913 Ga0207695_10482066 Ga0207695_104820662 244
151 3300025914 Ga0207671_10005503 Ga0207671_100055036 244
152 3300025914 Ga0207671_10008026 Ga0207671_100080265 244
153 3300025914 Ga0207671_10069093 Ga0207671_100690932 244
154 3300025919 Ga0207657_10055672 Ga0207657_100556724 244
155 3300025924 Ga0207694_10137404 Ga0207694_101374042 244
156 3300026078 Ga0207702_10217695 Ga0207702_102176951 244
157 3300028794 Ga0307515_10000135 Ga0307515_1000013584 244
158 3300031548 Ga0307408_100021074 Ga0307408_1000210743 244
159 3300050493 nmdc:mga0k408_9422_c1 nmdc:mga0k408_9422_c1_4096_4839 244
160 3300053080 Ga0500635_0008099 Ga0500635_0008099_1795_2529 244
161 3300053130 Ga0500642_0041731 Ga0500642_0041731_661_1395 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

160

239

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b9n-assembly2.cif.gz_C crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site 0.9078 1 243
7z5a-assembly1.cif.gz_A crystal structure of the trapped complex of mouse endonuclease viii-like 3 (mneil3) and hairpin dna with 5'overhang 0.9072 1 241
3w0f-assembly1.cif.gz_A crystal structure of mouse endonuclease viii-like 3 (mneil3) 0.9046 3 241
8b9n-assembly2.cif.gz_C crystal structure of nei domain of mouse neil3 trapped in covalent complex with ssdna with abasic site 0.9005 1 243
7z5a-assembly1.cif.gz_A crystal structure of the trapped complex of mouse endonuclease viii-like 3 (mneil3) and hairpin dna with 5'overhang 0.8931 1 241
ID Description Score Start End Superfamily
af_Q8TAT5_147_286_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9469 113 243 1.10.8.50
af_D4ABX3_187_320_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9135 110 244 1.10.8.50
af_D4ABX3_187_320_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.907 110 244 1.10.8.50
1kfvB02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8836 115 236 1.10.8.50
af_Q8TAT5_147_286_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8825 113 243 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A4Q5V6F7-F1-model_v4 deleted 0.9969 150 244
AF-A0A317LYH6-F1-model_v4 Endonuclease-8 0.9922 1 243 GO:0003684
GO:0004519
GO:0006284
GO:0008270
GO:0019104
GO:0140078
AF-A0A561C7A2-F1-model_v4 deleted 0.9892 1 244
AF-A0A4Q6DZ55-F1-model_v4 Endonuclease 0.9891 1 236 GO:0003684
GO:0004519
GO:0006284
GO:0008270
GO:0019104
GO:0140078
AF-A0A4V2EZN8-F1-model_v4 Endonuclease-8 0.989 1 243 GO:0003684
GO:0004519
GO:0006284
GO:0008270
GO:0019104
GO:0140078

Feature Viewer

pLDDT pTM Quality
96.21 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map