F236725

General Info

Members Datasets Scaffolds Average Seq Length
161 122 322 85

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100555755|Ga0075431_1005557552
Length 100
Sequence MVFARPFGCSYTVITVPTKTRIVRIGNSRGIRIPKTLLDEAELPEDVELHAQPGRLVVQAARRPRSGWAAAAKRMRARGDDAFLDESTATKFDRGEWKWR

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
64 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
65 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
73 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
74 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
75 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
76 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
77 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
78 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
119 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
120 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 0
Rhizoplane 2.48
Rhizosphere 93.79
Stem 0
Stem Tuber 0
Unclassified 37.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100555755 3300006847 Bacteria 1135
2 Ga0065715_10713022 3300005293 Unclassified 647
3 Ga0065707_10228585 3300005295 Unclassified 1197
4 Ga0070680_100100883 3300005336 Bacteria 2396
5 Ga0070689_100339748 3300005340 Unclassified 1257
6 Ga0070692_10011232 3300005345 Unclassified 4106
7 Ga0070669_100440216 3300005353 Bacteria 1073
8 Ga0070703_10142703 3300005406 Bacteria 891
9 Ga0070705_101600082 3300005440 Unclassified 548
10 Ga0070694_100000446 3300005444 Bacteria 22573
11 Ga0070694_100535111 3300005444 Unclassified 936
12 Ga0070708_100035983 3300005445 Unclassified 4316
13 Ga0070708_100176766 3300005445 Bacteria 1995
14 Ga0070662_101379505 3300005457 Unclassified 607
15 Ga0070706_101907202 3300005467 Unclassified 539
16 Ga0070707_100057235 3300005468 Bacteria 3740
17 Ga0070707_100130176 3300005468 Bacteria 2447
18 Ga0070707_100187303 3300005468 Bacteria 2018
19 Ga0070698_101969890 3300005471 Unclassified 537
20 Ga0070699_100194142 3300005518 Bacteria 1804
21 Ga0070699_101714960 3300005518 Unclassified 575
22 Ga0070679_101129969 3300005530 Unclassified 728
23 Ga0070697_100815093 3300005536 Unclassified 826
24 Ga0070695_100191629 3300005545 Unclassified 1455
25 Ga0070695_101086176 3300005545 Unclassified 654
26 Ga0070696_100596720 3300005546 Bacteria 890
27 Ga0070696_100631835 3300005546 Unclassified 866
28 Ga0070696_101422588 3300005546 Unclassified 592
29 Ga0070704_100118869 3300005549 Unclassified 2026
30 Ga0070704_100228252 3300005549 Bacteria 1517
31 Ga0068852_101195622 3300005616 Bacteria 781
32 Ga0068861_102298669 3300005719 Unclassified 541
33 Ga0068858_101007921 3300005842 Unclassified 816
34 Ga0081539_10155756 3300005985 Bacteria 1094
35 Ga0070717_11098447 3300006028 Unclassified 724
36 Ga0075433_10004258 3300006852 Bacteria 11115
37 Ga0075434_100105354 3300006871 Bacteria 2830
38 Ga0075434_102424762 3300006871 Bacteria 526
39 Ga0075436_100019595 3300006914 Bacteria 4637
40 Ga0075435_100420581 3300007076 Bacteria 1151
41 Ga0099794_10249346 3300007265 Bacteria 915
42 Ga0114129_10034410 3300009147 Bacteria 7156
43 Ga0114129_10285470 3300009147 Bacteria 2204
44 Ga0114129_11061124 3300009147 Bacteria 1016
45 Ga0105243_11186859 3300009148 Unclassified 776
46 Ga0105242_10656461 3300009176 Bacteria 1021
47 Ga0105248_10140979 3300009177 Bacteria 2719
48 Ga0105239_12052291 3300010375 Bacteria 664
49 Ga0157369_10305202 3300013105 Bacteria 1655
50 Ga0157369_10891593 3300013105 Bacteria 912
51 Ga0157379_11073346 3300014968 Bacteria 770
52 Ga0213873_10313697 3300021358 Bacteria 508
53 Ga0213876_10006095 3300021384 Bacteria 6588
54 Ga0213876_10027179 3300021384 Bacteria 3019
55 Ga0213876_10557989 3300021384 Unclassified 609
56 Ga0207705_11255234 3300025909 Bacteria 567
57 Ga0207684_10027633 3300025910 Bacteria 4832
58 Ga0207660_10171974 3300025917 Bacteria 1677
59 Ga0207652_11724913 3300025921 Unclassified 531
60 Ga0207646_10055520 3300025922 Bacteria 3541
61 Ga0207706_10499030 3300025933 Unclassified 1051
62 Ga0207670_10297679 3300025936 Unclassified 1262
63 Ga0207711_10108802 3300025941 Bacteria 2463
64 Ga0207703_10782374 3300026035 Unclassified 910
65 Ga0207678_11697744 3300026067 Unclassified 555
66 Ga0207708_10356999 3300026075 Bacteria 1200
67 Ga0207698_10953617 3300026142 Bacteria 867
68 Ga0209971_1019647 3300027682 Unclassified 1604
69 Ga0307408_100487914 3300031548 Bacteria 1076
70 Ga0316579_10666482 3300031691 Unclassified 504
71 Ga0316576_10472409 3300031727 Bacteria 925
72 Ga0316578_10024772 3300031728 Bacteria 3369
73 Ga0307405_10333675 3300031731 Bacteria 1163
74 Ga0307405_12018347 3300031731 Unclassified 516
75 Ga0316577_10000667 3300031733 Bacteria 14363
76 Ga0307412_10109825 3300031911 Bacteria 1967
77 Ga0307412_11879873 3300031911 Bacteria 552
78 Ga0307409_101727688 3300031995 Unclassified 654
79 Ga0307416_100997667 3300032002 Unclassified 940
80 Ga0316585_10072311 3300032137 Unclassified 1120
81 Ga0316574_0061203 3300035398 Unclassified 2364
82 Ga0316574_0609400 3300035398 Bacteria 674
83 Ga0316582_0207106 3300036647 Unclassified 1339
84 Ga0316584_0008120 3300036712 Bacteria 7212
85 Ga0395900_0136086 3300037418 Bacteria 2517
86 Ga0395898_0830385 3300037466 Bacteria 864
87 Ga0395898_1362489 3300037466 Unclassified 638
88 Ga0395905_0056061 3300037471 Bacteria 3688
89 Ga0395901_1823920 3300038443 Bacteria 557
90 Ga0436365_0493057 3300039437 Bacteria 2215
91 Ga0436365_0814339 3300039437 Bacteria 6442
92 Ga0436362_0053709 3300039453 Bacteria 667
93 Ga0439433_0221991 3300041999 Unclassified 504
94 Ga0439435_0028908 3300042436 Unclassified 1493
95 Ga0439460_0238892 3300042461 Unclassified 626
96 Ga0453683_0512138 3300044673 Unclassified 779
97 Ga0466963_0392998 3300044694 Bacteria 978
98 Ga0453684_1246758 3300044712 Bacteria 778
99 Ga0451576_0371389 3300045051 Bacteria 1499
100 Ga0495594_0392602 3300046499 Bacteria 790
101 Ga0495674_0757368 3300047319 Bacteria 758
102 Ga0496105_1128532 3300048908 Unclassified 581
103 Ga0496109_1520560 3300048912 Unclassified 604
104 Ga0496110_1323833 3300048913 Unclassified 630
105 Ga0496113_0489294 3300048916 Unclassified 988
106 Ga0501031_0286408 3300049568 Bacteria 1068
107 Ga0501032_0955769 3300049569 Unclassified 539
108 Ga0501033_0074075 3300049570 Bacteria 2500
109 Ga0501033_0558683 3300049570 Bacteria 788
110 Ga0501036_0362580 3300049572 Bacteria 1210
111 Ga0501037_0039615 3300049573 Bacteria 3469
112 Ga0501037_0081211 3300049573 Unclassified 2351
113 Ga0501038_0478331 3300049574 Bacteria 955
114 Ga0501039_0443777 3300049575 Bacteria 1019
115 Ga0501039_0835519 3300049575 Unclassified 718
116 Ga0501040_0523689 3300049576 Bacteria 855
117 Ga0501041_0342714 3300049577 Bacteria 944
118 Ga0501042_0054683 3300049578 Bacteria 2848
119 Ga0501043_0285934 3300049579 Bacteria 1263
120 Ga0501046_0216324 3300049580 Bacteria 1421
121 Ga0501046_0383815 3300049580 Bacteria 1016
122 Ga0501047_0019668 3300049581 Bacteria 6479
123 Ga0501048_0089625 3300049582 Bacteria 2170
124 Ga0501071_0274728 3300049587 Bacteria 1275
125 Ga0501071_1284071 3300049587 Bacteria 565
126 Ga0501071_1445478 3300049587 Unclassified 531
127 Ga0501073_1279151 3300049589 Unclassified 503
128 Ga0501074_0118880 3300049590 Bacteria 1890
129 Ga0501074_0355778 3300049590 Unclassified 1039
130 Ga0501075_0131476 3300049591 Bacteria 1907
131 Ga0501075_0208035 3300049591 Bacteria 1492
132 Ga0501075_1067983 3300049591 Unclassified 613
133 Ga0501076_0032938 3300049592 Bacteria 4046
134 Ga0501076_0830493 3300049592 Bacteria 762
135 Ga0501077_0129586 3300049593 Bacteria 1599
136 Ga0501077_0241933 3300049593 Bacteria 1147
137 Ga0501199_035772 3300049650 Unclassified 628
138 Ga0501079_0280498 3300049741 Bacteria 1303
139 Ga0501079_0716742 3300049741 Bacteria 787
140 Ga0501080_0978265 3300049742 Bacteria 735
141 Ga0501035_0003185 3300049822 Bacteria 15729
142 Ga0501035_0130015 3300049822 Bacteria 2196
143 Ga0501045_0052470 3300049824 Bacteria 2977
144 nmdc:mga05p37_20790_c1 3300050507 Bacteria 7943
145 nmdc:mga05p37_277013_c1 3300050507 Unclassified 2002
146 nmdc:mga09592_1722500_c1 3300050508 Unclassified 505
147 nmdc:mga06r32_540513_c1 3300050510 Bacteria 1140
148 nmdc:mga0n895_12590_c1 3300050512 Bacteria 7593
149 nmdc:mga0n895_2144661_c1 3300050512 Unclassified 515
150 nmdc:mga0rr50_1719894_c1 3300050513 Unclassified 528
151 nmdc:mga0rr50_30437_c1 3300050513 Bacteria 3821
152 nmdc:mga08x19_220523_c1 3300050514 Bacteria 1303
153 nmdc:mga0a205_262629_c1 3300050515 Bacteria 1604
154 nmdc:mga0a205_289470_c1 3300050515 Bacteria 1513
155 nmdc:mga0a205_744486_c1 3300050515 Unclassified 829
156 Ga0500568_0002947 3300053139 Bacteria 9742
157 Ga0501084_0117185 3300054114 Bacteria 2239
158 Ga0501084_0539599 3300054114 Unclassified 986
159 Ga0590071_036215 3300059421 Unclassified 1183
160 Ga0501082_0786979 3300060353 Bacteria 832
161 Ga0530510_0132151 3300061734 Bacteria 1836
162 Ga0075431_100555755
163 Ga0065715_10713022
164 Ga0065707_10228585
165 Ga0070680_100100883
166 Ga0070689_100339748
167 Ga0070692_10011232
168 Ga0070669_100440216
169 Ga0070703_10142703
170 Ga0070705_101600082
171 Ga0070694_100000446
172 Ga0070694_100535111
173 Ga0070708_100035983
174 Ga0070708_100176766
175 Ga0070662_101379505
176 Ga0070706_101907202
177 Ga0070707_100057235
178 Ga0070707_100130176
179 Ga0070707_100187303
180 Ga0070698_101969890
181 Ga0070699_100194142
182 Ga0070699_101714960
183 Ga0070679_101129969
184 Ga0070697_100815093
185 Ga0070695_100191629
186 Ga0070695_101086176
187 Ga0070696_100596720
188 Ga0070696_100631835
189 Ga0070696_101422588
190 Ga0070704_100118869
191 Ga0070704_100228252
192 Ga0068852_101195622
193 Ga0068861_102298669
194 Ga0068858_101007921
195 Ga0081539_10155756
196 Ga0070717_11098447
197 Ga0075433_10004258
198 Ga0075434_100105354
199 Ga0075434_102424762
200 Ga0075436_100019595
201 Ga0075435_100420581
202 Ga0099794_10249346
203 Ga0114129_10034410
204 Ga0114129_10285470
205 Ga0114129_11061124
206 Ga0105243_11186859
207 Ga0105242_10656461
208 Ga0105248_10140979
209 Ga0105239_12052291
210 Ga0157369_10305202
211 Ga0157369_10891593
212 Ga0157379_11073346
213 Ga0213873_10313697
214 Ga0213876_10006095
215 Ga0213876_10027179
216 Ga0213876_10557989
217 Ga0207705_11255234
218 Ga0207684_10027633
219 Ga0207660_10171974
220 Ga0207652_11724913
221 Ga0207646_10055520
222 Ga0207706_10499030
223 Ga0207670_10297679
224 Ga0207711_10108802
225 Ga0207703_10782374
226 Ga0207678_11697744
227 Ga0207708_10356999
228 Ga0207698_10953617
229 Ga0209971_1019647
230 Ga0307408_100487914
231 Ga0316579_10666482
232 Ga0316576_10472409
233 Ga0316578_10024772
234 Ga0307405_10333675
235 Ga0307405_12018347
236 Ga0316577_10000667
237 Ga0307412_10109825
238 Ga0307412_11879873
239 Ga0307409_101727688
240 Ga0307416_100997667
241 Ga0316585_10072311
242 Ga0316574_0061203
243 Ga0316574_0609400
244 Ga0316582_0207106
245 Ga0316584_0008120
246 Ga0395900_0136086
247 Ga0395898_0830385
248 Ga0395898_1362489
249 Ga0395905_0056061
250 Ga0395901_1823920
251 Ga0436365_0493057
252 Ga0436365_0814339
253 Ga0436362_0053709
254 Ga0439433_0221991
255 Ga0439435_0028908
256 Ga0439460_0238892
257 Ga0453683_0512138
258 Ga0466963_0392998
259 Ga0453684_1246758
260 Ga0451576_0371389
261 Ga0495594_0392602
262 Ga0495674_0757368
263 Ga0496105_1128532
264 Ga0496109_1520560
265 Ga0496110_1323833
266 Ga0496113_0489294
267 Ga0501031_0286408
268 Ga0501032_0955769
269 Ga0501033_0074075
270 Ga0501033_0558683
271 Ga0501036_0362580
272 Ga0501037_0039615
273 Ga0501037_0081211
274 Ga0501038_0478331
275 Ga0501039_0443777
276 Ga0501039_0835519
277 Ga0501040_0523689
278 Ga0501041_0342714
279 Ga0501042_0054683
280 Ga0501043_0285934
281 Ga0501046_0216324
282 Ga0501046_0383815
283 Ga0501047_0019668
284 Ga0501048_0089625
285 Ga0501071_0274728
286 Ga0501071_1284071
287 Ga0501071_1445478
288 Ga0501073_1279151
289 Ga0501074_0118880
290 Ga0501074_0355778
291 Ga0501075_0131476
292 Ga0501075_0208035
293 Ga0501075_1067983
294 Ga0501076_0032938
295 Ga0501076_0830493
296 Ga0501077_0129586
297 Ga0501077_0241933
298 Ga0501199_035772
299 Ga0501079_0280498
300 Ga0501079_0716742
301 Ga0501080_0978265
302 Ga0501035_0003185
303 Ga0501035_0130015
304 Ga0501045_0052470
305 nmdc:mga05p37_20790_c1
306 nmdc:mga05p37_277013_c1
307 nmdc:mga09592_1722500_c1
308 nmdc:mga06r32_540513_c1
309 nmdc:mga0n895_12590_c1
310 nmdc:mga0n895_2144661_c1
311 nmdc:mga0rr50_1719894_c1
312 nmdc:mga0rr50_30437_c1
313 nmdc:mga08x19_220523_c1
314 nmdc:mga0a205_262629_c1
315 nmdc:mga0a205_289470_c1
316 nmdc:mga0a205_744486_c1
317 Ga0500568_0002947
318 Ga0501084_0117185
319 Ga0501084_0539599
320 Ga0590071_036215
321 Ga0501082_0786979
322 Ga0530510_0132151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map