F236396

General Info

Members Datasets Scaffolds Average Seq Length
161 96 322 155

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100262032|Ga0070708_1002620322
Length 179
Sequence MEKGPVLTSPYEEFFHMKVILLQDVDGLGKAGDLKEVANGYARNYLLPRQLAAGATSALVANRKQRIASEQRKIEKQAELDRQQAERLSQVTLTFKARVGRQGRLYGSITSQDIAAGLYETEGITLDRRAIEMPDPIRTLGTFEVPIRVAQKVHPKITVRVINANETEQPAETSEEVNA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
25 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
26 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
27 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
33 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
42 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
62 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
63 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
64 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
65 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
68 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
93 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
94 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 70.19
Metatranscriptomes 29.81
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0
Rhizoplane 0.62
Rhizosphere 87.58
Stem 0
Stem Tuber 0
Unclassified 28.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100262032 3300005445 Bacteria 1625
2 Ga0058863_10014369 3300004799 Unclassified 626
3 Ga0058863_10174274 3300004799 Bacteria 970
4 Ga0058860_11041546 3300004801 Unclassified 619
5 Ga0058860_11719377 3300004801 Unclassified 693
6 Ga0058862_10023619 3300004803 Unclassified 630
7 Ga0058862_10051234 3300004803 Unclassified 759
8 Ga0058862_11934001 3300004803 Unclassified 564
9 Ga0070658_11015699 3300005327 Bacteria 721
10 Ga0070689_100086252 3300005340 Bacteria 2469
11 Ga0070691_10002656 3300005341 Bacteria 7962
12 Ga0070669_100919239 3300005353 Bacteria 748
13 Ga0070671_100021708 3300005355 Bacteria 5244
14 Ga0070688_101661244 3300005365 Bacteria 522
15 Ga0070667_102159639 3300005367 Unclassified 524
16 Ga0070714_100878154 3300005435 Unclassified 870
17 Ga0070713_100750060 3300005436 Bacteria 934
18 Ga0070707_100529983 3300005468 Unclassified 1140
19 Ga0070698_100160264 3300005471 Unclassified 2194
20 Ga0070698_100272933 3300005471 Unclassified 1622
21 Ga0070698_100304330 3300005471 Unclassified 1525
22 Ga0070686_100043642 3300005544 Bacteria 2814
23 Ga0068855_100001669 3300005563 Bacteria 27757
24 Ga0068854_100287448 3300005578 Bacteria 1326
25 Ga0068858_101816500 3300005842 Bacteria 602
26 Ga0070717_10826901 3300006028 Unclassified 843
27 Ga0068871_100781414 3300006358 Unclassified 879
28 Ga0105240_10621275 3300009093 Bacteria 1187
29 Ga0105242_10311039 3300009176 Bacteria 1441
30 Ga0130087_1054705 3300009828 Bacteria 679
31 Ga0130086_1100555 3300009829 Bacteria 679
32 Ga0130084_1074123 3300009835 Bacteria 679
33 Ga0130084_1092456 3300009835 Bacteria 526
34 Ga0130085_1010707 3300009850 Bacteria 526
35 Ga0130085_1118582 3300009850 Bacteria 679
36 Ga0105239_10977552 3300010375 Bacteria 973
37 Ga0197907_10973943 3300020069 Bacteria 821
38 Ga0197907_11207129 3300020069 Unclassified 653
39 Ga0197907_11228470 3300020069 Unclassified 540
40 Ga0206356_10028891 3300020070 Unclassified 658
41 Ga0206356_10766414 3300020070 Bacteria 536
42 Ga0206356_11153490 3300020070 Unclassified 536
43 Ga0206356_11304849 3300020070 Bacteria 823
44 Ga0206356_11801644 3300020070 Unclassified 671
45 Ga0206349_1081810 3300020075 Unclassified 615
46 Ga0206349_1226940 3300020075 Unclassified 619
47 Ga0206355_1081826 3300020076 Unclassified 728
48 Ga0206355_1185848 3300020076 Bacteria 541
49 Ga0206355_1193076 3300020076 Bacteria 863
50 Ga0206355_1252464 3300020076 Unclassified 586
51 Ga0206351_10237069 3300020077 Unclassified 563
52 Ga0206351_10669911 3300020077 Bacteria 756
53 Ga0206351_10837163 3300020077 Unclassified 651
54 Ga0206352_10247539 3300020078 Unclassified 631
55 Ga0206352_10893931 3300020078 Unclassified 663
56 Ga0206352_10938269 3300020078 Bacteria 795
57 Ga0206350_10013321 3300020080 Bacteria 778
58 Ga0206350_10594966 3300020080 Unclassified 594
59 Ga0206350_10679507 3300020080 Unclassified 608
60 Ga0206350_11090533 3300020080 Unclassified 634
61 Ga0206354_10762704 3300020081 Bacteria 785
62 Ga0206354_11663528 3300020081 Unclassified 549
63 Ga0206353_11062285 3300020082 Bacteria 745
64 Ga0154015_1051271 3300020610 Bacteria 664
65 Ga0213874_10000003 3300021377 Bacteria 31520
66 Ga0213874_10001400 3300021377 Bacteria 4986
67 Ga0213876_10141655 3300021384 Bacteria 1279
68 Ga0213875_10026274 3300021388 Unclassified 2770
69 Ga0213875_10050327 3300021388 Bacteria 1952
70 Ga0224712_10245761 3300022467 Bacteria 825
71 Ga0224712_10249087 3300022467 Unclassified 820
72 Ga0224712_10266924 3300022467 Bacteria 794
73 Ga0224712_10430274 3300022467 Unclassified 632
74 Ga0224712_10592019 3300022467 Bacteria 541
75 Ga0207684_10001889 3300025910 Bacteria 21797
76 Ga0207646_10334991 3300025922 Unclassified 1367
77 Ga0207644_10003281 3300025931 Bacteria 10457
78 Ga0207667_10001594 3300025949 Bacteria 28505
79 Ga0207703_11419569 3300026035 Bacteria 668
80 Ga0207639_10057691 3300026041 Bacteria 2983
81 Ga0207683_10611024 3300026121 Bacteria 1009
82 Ga0265338_10007011 3300028800 Bacteria 14146
83 Ga0265340_10032618 3300031247 Bacteria 2599
84 Ga0307408_100111839 3300031548 Bacteria 2099
85 Ga0307405_10257879 3300031731 Bacteria 1301
86 Ga0307406_10499499 3300031901 Bacteria 986
87 Ga0307412_10076860 3300031911 Bacteria 2295
88 Ga0307409_100806795 3300031995 Bacteria 946
89 Ga0307416_100043442 3300032002 Bacteria 3519
90 Ga0307416_100341527 3300032002 Bacteria 1510
91 Ga0307416_102049582 3300032002 Bacteria 674
92 Ga0307411_10730455 3300032005 Bacteria 865
93 Ga0307415_100546921 3300032126 Bacteria 1021
94 Ga0307415_100679380 3300032126 Bacteria 926
95 Ga0307415_100799399 3300032126 Bacteria 861
96 Ga0373933_0006183 3300035724 Bacteria 6517
97 Ga0316582_0619067 3300036647 Unclassified 745
98 Ga0395898_0526290 3300037466 Bacteria 1124
99 Ga0436364_0088960 3300037853 Bacteria 830
100 Ga0436364_0900019 3300037853 Bacteria 4884
101 Ga0400490_17918 3300038726 Bacteria 39309
102 Ga0400491_12201 3300038727 Bacteria 3143
103 Ga0436365_0728868 3300039437 Bacteria 1714
104 Ga0436365_1013957 3300039437 Bacteria 2537
105 Ga0436365_1603794 3300039437 Bacteria 1606
106 Ga0436363_0008179 3300039450 Bacteria 4073
107 Ga0436363_0815419 3300039450 Unclassified 1148
108 Ga0436363_1614354 3300039450 Bacteria 39631
109 Ga0436362_0098827 3300039453 Bacteria 20005
110 Ga0451577_0009643 3300042876 Bacteria 9268
111 Ga0451577_0086496 3300042876 Bacteria 2796
112 Ga0451577_0101137 3300042876 Unclassified 2576
113 Ga0451577_0343843 3300042876 Bacteria 1353
114 Ga0466969_0023289 3300044656 Unclassified 3191
115 Ga0466969_0035122 3300044656 Bacteria 2536
116 Ga0466969_0050601 3300044656 Bacteria 2048
117 Ga0466972_0035949 3300044658 Bacteria 2425
118 Ga0453683_0024052 3300044673 Bacteria 3879
119 Ga0466966_0011127 3300044684 Bacteria 5969
120 Ga0466966_0017104 3300044684 Bacteria 4797
121 Ga0466966_0064872 3300044684 Bacteria 2298
122 Ga0466961_0007602 3300044693 Bacteria 6902
123 Ga0466961_0097414 3300044693 Bacteria 1854
124 Ga0466961_0584440 3300044693 Unclassified 672
125 Ga0466964_0001378 3300044706 Bacteria 8292
126 Ga0453684_0003174 3300044712 Bacteria 37753
127 Ga0453684_0004170 3300044712 Bacteria 31173
128 Ga0453684_0008901 3300044712 Bacteria 17777
129 Ga0453684_0009973 3300044712 Bacteria 16372
130 Ga0453684_0030632 3300044712 Bacteria 7593
131 Ga0453684_0144271 3300044712 Bacteria 2838
132 Ga0453684_0304865 3300044712 Bacteria 1809
133 Ga0453684_0461788 3300044712 Unclassified 1412
134 Ga0453684_0846899 3300044712 Bacteria 983
135 Ga0466971_0028397 3300044719 Bacteria 2502
136 Ga0466968_0000224 3300044735 Bacteria 17678
137 Ga0466970_0000727 3300044765 Bacteria 16088
138 Ga0466970_0112023 3300044765 Bacteria 1490
139 Ga0466957_0019192 3300044842 Unclassified 4021
140 Ga0466957_0020725 3300044842 Bacteria 3869
141 Ga0466957_0662873 3300044842 Bacteria 734
142 Ga0466959_0005799 3300045049 Bacteria 8506
143 Ga0466959_0075454 3300045049 Bacteria 2436
144 Ga0466959_0231323 3300045049 Bacteria 1279
145 Ga0451576_0175439 3300045051 Bacteria 2237
146 Ga0451576_0387708 3300045051 Bacteria 1464
147 Ga0466958_0006844 3300045836 Bacteria 6232
148 Ga0466958_0327592 3300045836 Bacteria 985
149 Ga0496108_0836981 3300048911 Unclassified 792
150 Ga0501031_0373324 3300049568 Bacteria 923
151 Ga0501034_0040613 3300049571 Bacteria 4709
152 Ga0501037_0012021 3300049573 Bacteria 6377
153 Ga0501038_1131983 3300049574 Bacteria 570
154 Ga0501039_0349554 3300049575 Bacteria 1162
155 Ga0501047_0058909 3300049581 Unclassified 3709
156 Ga0501044_0006426 3300049823 Bacteria 12984
157 Ga0500568_0002007 3300053139 Bacteria 12388
158 Ga0500637_0124214 3300053178 Bacteria 1497
159 Ga0587073_0249998 3300059492 Unclassified 556
160 Ga0587085_067109 3300059506 Unclassified 693
161 Ga0466962_0019187 3300061719 Bacteria 3283
162 Ga0070708_100262032
163 Ga0058863_10014369
164 Ga0058863_10174274
165 Ga0058860_11041546
166 Ga0058860_11719377
167 Ga0058862_10023619
168 Ga0058862_10051234
169 Ga0058862_11934001
170 Ga0070658_11015699
171 Ga0070689_100086252
172 Ga0070691_10002656
173 Ga0070669_100919239
174 Ga0070671_100021708
175 Ga0070688_101661244
176 Ga0070667_102159639
177 Ga0070714_100878154
178 Ga0070713_100750060
179 Ga0070707_100529983
180 Ga0070698_100160264
181 Ga0070698_100272933
182 Ga0070698_100304330
183 Ga0070686_100043642
184 Ga0068855_100001669
185 Ga0068854_100287448
186 Ga0068858_101816500
187 Ga0070717_10826901
188 Ga0068871_100781414
189 Ga0105240_10621275
190 Ga0105242_10311039
191 Ga0130087_1054705
192 Ga0130086_1100555
193 Ga0130084_1074123
194 Ga0130084_1092456
195 Ga0130085_1010707
196 Ga0130085_1118582
197 Ga0105239_10977552
198 Ga0197907_10973943
199 Ga0197907_11207129
200 Ga0197907_11228470
201 Ga0206356_10028891
202 Ga0206356_10766414
203 Ga0206356_11153490
204 Ga0206356_11304849
205 Ga0206356_11801644
206 Ga0206349_1081810
207 Ga0206349_1226940
208 Ga0206355_1081826
209 Ga0206355_1185848
210 Ga0206355_1193076
211 Ga0206355_1252464
212 Ga0206351_10237069
213 Ga0206351_10669911
214 Ga0206351_10837163
215 Ga0206352_10247539
216 Ga0206352_10893931
217 Ga0206352_10938269
218 Ga0206350_10013321
219 Ga0206350_10594966
220 Ga0206350_10679507
221 Ga0206350_11090533
222 Ga0206354_10762704
223 Ga0206354_11663528
224 Ga0206353_11062285
225 Ga0154015_1051271
226 Ga0213874_10000003
227 Ga0213874_10001400
228 Ga0213876_10141655
229 Ga0213875_10026274
230 Ga0213875_10050327
231 Ga0224712_10245761
232 Ga0224712_10249087
233 Ga0224712_10266924
234 Ga0224712_10430274
235 Ga0224712_10592019
236 Ga0207684_10001889
237 Ga0207646_10334991
238 Ga0207644_10003281
239 Ga0207667_10001594
240 Ga0207703_11419569
241 Ga0207639_10057691
242 Ga0207683_10611024
243 Ga0265338_10007011
244 Ga0265340_10032618
245 Ga0307408_100111839
246 Ga0307405_10257879
247 Ga0307406_10499499
248 Ga0307412_10076860
249 Ga0307409_100806795
250 Ga0307416_100043442
251 Ga0307416_100341527
252 Ga0307416_102049582
253 Ga0307411_10730455
254 Ga0307415_100546921
255 Ga0307415_100679380
256 Ga0307415_100799399
257 Ga0373933_0006183
258 Ga0316582_0619067
259 Ga0395898_0526290
260 Ga0436364_0088960
261 Ga0436364_0900019
262 Ga0400490_17918
263 Ga0400491_12201
264 Ga0436365_0728868
265 Ga0436365_1013957
266 Ga0436365_1603794
267 Ga0436363_0008179
268 Ga0436363_0815419
269 Ga0436363_1614354
270 Ga0436362_0098827
271 Ga0451577_0009643
272 Ga0451577_0086496
273 Ga0451577_0101137
274 Ga0451577_0343843
275 Ga0466969_0023289
276 Ga0466969_0035122
277 Ga0466969_0050601
278 Ga0466972_0035949
279 Ga0453683_0024052
280 Ga0466966_0011127
281 Ga0466966_0017104
282 Ga0466966_0064872
283 Ga0466961_0007602
284 Ga0466961_0097414
285 Ga0466961_0584440
286 Ga0466964_0001378
287 Ga0453684_0003174
288 Ga0453684_0004170
289 Ga0453684_0008901
290 Ga0453684_0009973
291 Ga0453684_0030632
292 Ga0453684_0144271
293 Ga0453684_0304865
294 Ga0453684_0461788
295 Ga0453684_0846899
296 Ga0466971_0028397
297 Ga0466968_0000224
298 Ga0466970_0000727
299 Ga0466970_0112023
300 Ga0466957_0019192
301 Ga0466957_0020725
302 Ga0466957_0662873
303 Ga0466959_0005799
304 Ga0466959_0075454
305 Ga0466959_0231323
306 Ga0451576_0175439
307 Ga0451576_0387708
308 Ga0466958_0006844
309 Ga0466958_0327592
310 Ga0496108_0836981
311 Ga0501031_0373324
312 Ga0501034_0040613
313 Ga0501037_0012021
314 Ga0501038_1131983
315 Ga0501039_0349554
316 Ga0501047_0058909
317 Ga0501044_0006426
318 Ga0500568_0002007
319 Ga0500637_0124214
320 Ga0587073_0249998
321 Ga0587085_067109
322 Ga0466962_0019187

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03948

Ribosomal_L9_C

Ribosomal protein L9, C-terminal domain

79

163

0.97

PF01281

Ribosomal_L9_N

Ribosomal protein L9, N-terminal domain

17

63

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_h clindamycin bound to the 50s subunit 1.003 1 40
8ceu-assembly1.cif.gz_h retapamulin and capreomycin bound to the 50s subunit 0.9985 1 40
8cam-assembly1.cif.gz_h evernimicin bound to the 50s subunit 0.9972 1 40
8cgk-assembly1.cif.gz_h lincomycin and avilamycin bound to the 50s subunit 0.9953 1 40
8fto-assembly1.cif.gz_h e. coli 70s ribosome with an improved ms2 tag inserted in h98 0.9937 1 40
ID Description Score Start End Superfamily
af_A0A1D6HNM4_48_91_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9773 3 44 3.40.5.10
af_Q2G2T3_1_54_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9497 1 50 3.40.5.10
af_Q2G2T3_62_150_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.9486 62 143 3.10.430.100
af_Q65XC5_114_204_3.10.430.100 Alpha Beta;Roll;Ribosomal Protein L9; domain 2;Ribosomal protein L9, C-terminal domain 0.939 64 142 3.10.430.100
af_Q54QM2_41_88_3.40.5.10 Alpha Beta;3-Layer(aba) Sandwich;Ribosomal Protein L9; domain 1;Ribosomal protein L9, N-terminal domain 0.9322 3 48 3.40.5.10
ID Description Score Start End GO Terms
AF-A0A7I8EUM0-F1-model_v4 Large ribosomal subunit protein bL9 0.9977 1 145 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1Q6XWN2-F1-model_v4 Large ribosomal subunit protein bL9 0.9729 1 145 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7I8EUM0-F1-model_v4 Large ribosomal subunit protein bL9 0.9518 1 145 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A536CI41-F1-model_v4 Large ribosomal subunit protein bL9 0.9363 1 143 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C3Z8A9-F1-model_v4 Large ribosomal subunit protein bL9 0.9349 1 143 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map