F235702

General Info

Members Datasets Scaffolds Average Seq Length
160 115 160 137

Family's Representative Sequence

Representative Sequence 3300053093|Ga0500651_0332039|Ga0500651_0332039_217_603
Length 128
Sequence MSDLETDSHRQDHAPGDEPEESGHWVQNANLGLGFSIVLTVAAFVLTGSNLIYQPAIPVALLVLAIAQMGVHLVFFLHITTGPDNTNNVLALAFGILVVFLIVAGSIWIMDHLEQNMMPMEQMMEMQP

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
98 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
103 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
114 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 1.88
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10007970 3300003316 Bacteria 2095
2 rootH1_10068810 3300003323 Bacteria 1706
3 rootH1_10111565 3300003323 Bacteria 2249
4 rootH1_10253678 3300003323 Bacteria 1116
5 Ga0070658_10206274 3300005327 Bacteria 1660
6 Ga0070658_10361284 3300005327 Bacteria 1244
7 Ga0070670_100000039 3300005331 Bacteria 152618
8 Ga0070666_10077094 3300005335 Bacteria 2275
9 Ga0070680_100272050 3300005336 Bacteria 1434
10 Ga0070660_100321380 3300005339 Bacteria 1271
11 Ga0070661_100500286 3300005344 Bacteria 973
12 Ga0070668_100000546 3300005347 Bacteria 25156
13 Ga0070668_100001090 3300005347 Bacteria 19137
14 Ga0070671_101073777 3300005355 Bacteria 707
15 Ga0070659_100000111 3300005366 Bacteria 60284
16 Ga0070659_100002577 3300005366 Bacteria 12877
17 Ga0070667_100000164 3300005367 Bacteria 82930
18 Ga0070667_100008914 3300005367 Bacteria 8303
19 Ga0070711_101264715 3300005439 Bacteria 640
20 Ga0070663_100198914 3300005455 Bacteria 1563
21 Ga0070681_10088493 3300005458 Bacteria 3048
22 Ga0070679_100083107 3300005530 Bacteria 3191
23 Ga0068853_100083587 3300005539 Bacteria 2797
24 Ga0070665_100004370 3300005548 Bacteria 14862
25 Ga0070665_100064446 3300005548 Bacteria 3675
26 Ga0070665_100304394 3300005548 Bacteria 1597
27 Ga0068855_100117982 3300005563 Bacteria 3039
28 Ga0068857_101968539 3300005577 Bacteria 573
29 Ga0068856_100310287 3300005614 Bacteria 1595
30 Ga0068859_100218810 3300005617 Bacteria 1992
31 Ga0068864_100000068 3300005618 Bacteria 115507
32 Ga0068864_102519044 3300005618 Bacteria 521
33 Ga0068863_100766141 3300005841 Bacteria 961
34 Ga0068863_102197202 3300005841 Bacteria 562
35 Ga0068858_100005289 3300005842 Bacteria 12653
36 Ga0068860_100000303 3300005843 Bacteria 68443
37 Ga0068862_100004089 3300005844 Bacteria 12372
38 Ga0068862_100016747 3300005844 Bacteria 6102
39 Ga0097620_100218811 3300006931 Bacteria 1992
40 Ga0105240_10716189 3300009093 Bacteria 1091
41 Ga0105240_11440657 3300009093 Bacteria 723
42 Ga0105247_10033114 3300009101 Bacteria 3142
43 Ga0105241_10561153 3300009174 Bacteria 1026
44 Ga0105248_10074775 3300009177 Bacteria 3808
45 Ga0105237_10520897 3300009545 Bacteria 1195
46 Ga0105238_10057694 3300009551 Bacteria 3892
47 Ga0105238_10414102 3300009551 Bacteria 1342
48 Ga0105238_10612252 3300009551 Bacteria 1097
49 Ga0105238_11095091 3300009551 Bacteria 819
50 Ga0105249_10001473 3300009553 Bacteria 20639
51 Ga0105249_10141832 3300009553 Bacteria 2305
52 Ga0105239_10380953 3300010375 Bacteria 1595
53 Ga0157371_10944448 3300013102 Bacteria 656
54 Ga0157370_10442860 3300013104 Bacteria 1195
55 Ga0157369_10675958 3300013105 Bacteria 1064
56 Ga0157374_10962846 3300013296 Bacteria 872
57 Ga0157372_10195078 3300013307 Bacteria 2346
58 Ga0157372_11413025 3300013307 Bacteria 802
59 Ga0163163_12465966 3300014325 Bacteria 578
60 Ga0157380_11688033 3300014326 Bacteria 691
61 Ga0182008_10778633 3300014497 Bacteria 553
62 Ga0157379_10033259 3300014968 Bacteria 4599
63 Ga0157376_11689000 3300014969 Bacteria 668
64 Ga0163161_10294687 3300017792 Bacteria 1276
65 Ga0213872_10014853 3300021361 Bacteria 3627
66 Ga0213874_10215524 3300021377 Bacteria 696
67 Ga0207680_10133808 3300025903 Bacteria 1636
68 Ga0207705_10123196 3300025909 Bacteria 1925
69 Ga0207707_10035948 3300025912 Bacteria 4331
70 Ga0207695_10311688 3300025913 Bacteria 1463
71 Ga0207660_10146215 3300025917 Bacteria 1812
72 Ga0207657_10017915 3300025919 Bacteria 6776
73 Ga0207657_10032016 3300025919 Bacteria 4756
74 Ga0207649_10303567 3300025920 Bacteria 1168
75 Ga0207652_10004499 3300025921 Bacteria 11325
76 Ga0207694_10417741 3300025924 Bacteria 1117
77 Ga0207694_10639348 3300025924 Bacteria 896
78 Ga0207650_10000161 3300025925 Bacteria 81097
79 Ga0207690_10002589 3300025932 Bacteria 10920
80 Ga0207690_10417805 3300025932 Bacteria 1072
81 Ga0207711_10306046 3300025941 Bacteria 1467
82 Ga0207711_10544049 3300025941 Bacteria 1083
83 Ga0207667_10005260 3300025949 Bacteria 15788
84 Ga0207712_10002142 3300025961 Bacteria 12906
85 Ga0207668_10000010 3300025972 Bacteria 185249
86 Ga0207668_10000323 3300025972 Bacteria 31013
87 Ga0207658_10000988 3300025986 Bacteria 23373
88 Ga0207658_10004212 3300025986 Bacteria 10020
89 Ga0207703_10000968 3300026035 Bacteria 27762
90 Ga0207639_10245472 3300026041 Bacteria 1559
91 Ga0207678_10535038 3300026067 Bacteria 1024
92 Ga0207702_10499403 3300026078 Bacteria 1186
93 Ga0207702_11026293 3300026078 Bacteria 818
94 Ga0207641_10455075 3300026088 Bacteria 1237
95 Ga0207676_10000685 3300026095 Bacteria 26828
96 Ga0207675_100081015 3300026118 Bacteria 3043
97 Ga0207683_10295262 3300026121 Bacteria 1482
98 Ga0207698_12169216 3300026142 Bacteria 569
99 Ga0268266_10003713 3300028379 Bacteria 15025
100 Ga0268266_10010699 3300028379 Bacteria 7994
101 Ga0268266_10948155 3300028379 Bacteria 832
102 Ga0268265_10002542 3300028380 Bacteria 13655
103 Ga0268265_10004500 3300028380 Bacteria 9648
104 Ga0268265_12024020 3300028380 Bacteria 583
105 Ga0268264_10000059 3300028381 Bacteria 306927
106 Ga0307410_11095179 3300031852 Bacteria 690
107 Ga0307414_10489440 3300032004 Bacteria 1086
108 Ga0395899_0009522 3300037312 Bacteria 7456
109 Ga0395900_0000008 3300037418 Bacteria 480459
110 Ga0395900_0027530 3300037418 Bacteria 5824
111 Ga0395900_0312858 3300037418 Bacteria 1553
112 Ga0395900_0464614 3300037418 Bacteria 1220
113 Ga0395900_0732581 3300037418 Bacteria 920
114 Ga0395898_0007219 3300037466 Bacteria 11790
115 Ga0395905_0011963 3300037471 Bacteria 8366
116 Ga0395905_0025829 3300037471 Bacteria 5537
117 Ga0395905_0048499 3300037471 Bacteria 3980
118 Ga0395905_0116660 3300037471 Bacteria 2509
119 Ga0395905_1033913 3300037471 Bacteria 725
120 Ga0436364_0762577 3300037853 Bacteria 970
121 Ga0395901_0000008 3300038443 Bacteria 495962
122 Ga0395901_0157781 3300038443 Bacteria 2383
123 Ga0395901_0177893 3300038443 Bacteria 2231
124 Ga0395901_0576645 3300038443 Bacteria 1137
125 Ga0395901_0808442 3300038443 Bacteria 926
126 Ga0436365_1294789 3300039437 Bacteria 762
127 Ga0436360_1086655 3300039438 Bacteria 750
128 Ga0436361_0287613 3300039447 Bacteria 1895
129 Ga0436361_0852795 3300039447 Bacteria 5111
130 Ga0436363_0608731 3300039450 Bacteria 1920
131 Ga0436362_0130700 3300039453 Bacteria 566
132 Ga0466969_0003262 3300044656 Bacteria 8624
133 Ga0466965_0537772 3300044683 Bacteria 659
134 Ga0466966_0004348 3300044684 Bacteria 9343
135 Ga0466961_0006390 3300044693 Bacteria 7481
136 Ga0466963_0159301 3300044694 Bacteria 1571
137 Ga0466971_0001280 3300044719 Bacteria 10492
138 Ga0466970_0006429 3300044765 Bacteria 5876
139 Ga0466957_0041607 3300044842 Bacteria 2778
140 Ga0466957_0479831 3300044842 Bacteria 860
141 Ga0466959_0009958 3300045049 Bacteria 6775
142 Ga0466958_0002312 3300045836 Bacteria 9506
143 Ga0466967_1198145 3300045976 Bacteria 757
144 Ga0495668_0061179 3300046616 Bacteria 2077
145 Ga0495611_0006190 3300046648 Bacteria 5106
146 Ga0495677_0207797 3300047445 Bacteria 762
147 Ga0496101_1205781 3300048904 Bacteria 593
148 Ga0496107_0727459 3300048910 Bacteria 729
149 Ga0496115_0439270 3300048918 Bacteria 1055
150 Ga0501032_0625918 3300049569 Bacteria 684
151 Ga0501034_0192300 3300049571 Bacteria 2002
152 Ga0501034_0523320 3300049571 Bacteria 1098
153 Ga0501047_0578049 3300049581 Bacteria 947
154 Ga0501035_0666702 3300049822 Bacteria 842
155 Ga0501035_1070079 3300049822 Bacteria 631
156 Ga0501044_0017012 3300049823 Bacteria 7802
157 Ga0501044_0157864 3300049823 Bacteria 2247
158 Ga0500643_028015 3300053087 Bacteria 1745
159 Ga0500651_0332039 3300053093 Bacteria 866
160 Ga0466962_0002154 3300061719 Bacteria 9309

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_1294789 Ga0436365_1294789_243_650 123
2 3300010375 Ga0105239_10380953 Ga0105239_103809534 124
3 3300003323 rootH1_10111565 rootH1_101115651 126
4 3300053093 Ga0500651_0332039 Ga0500651_0332039_217_603 127
5 3300014326 Ga0157380_11688033 Ga0157380_116880331 130
6 3300049571 Ga0501034_0523320 Ga0501034_0523320_455_871 130
7 3300005455 Ga0070663_100198914 Ga0070663_1001989144 131
8 3300026067 Ga0207678_10535038 Ga0207678_105350382 131
9 3300005614 Ga0068856_100310287 Ga0068856_1003102871 132
10 3300026078 Ga0207702_11026293 Ga0207702_110262932 132
11 3300005327 Ga0070658_10361284 Ga0070658_103612842 134
12 3300014497 Ga0182008_10778633 Ga0182008_107786332 134
13 3300021361 Ga0213872_10014853 Ga0213872_100148533 134
14 3300039447 Ga0436361_0287613 Ga0436361_0287613_773_1192 134
15 3300039447 Ga0436361_0852795 Ga0436361_0852795_654_1073 134
16 3300048918 Ga0496115_0439270 Ga0496115_0439270_382_789 134
17 3300005331 Ga0070670_100000039 Ga0070670_100000039128 135
18 3300005335 Ga0070666_10077094 Ga0070666_100770943 135
19 3300005347 Ga0070668_100001090 Ga0070668_1000010903 135
20 3300005367 Ga0070667_100000164 Ga0070667_1000001643 135
21 3300005548 Ga0070665_100064446 Ga0070665_1000644463 135
22 3300005617 Ga0068859_100218810 Ga0068859_1002188102 135
23 3300005618 Ga0068864_100000068 Ga0068864_10000006870 135
24 3300005841 Ga0068863_100766141 Ga0068863_1007661412 135
25 3300005842 Ga0068858_100005289 Ga0068858_1000052899 135
26 3300005843 Ga0068860_100000303 Ga0068860_10000030317 135
27 3300005844 Ga0068862_100004089 Ga0068862_1000040894 135
28 3300006931 Ga0097620_100218811 Ga0097620_1002188113 135
29 3300009101 Ga0105247_10033114 Ga0105247_100331143 135
30 3300009177 Ga0105248_10074775 Ga0105248_100747753 135
31 3300009553 Ga0105249_10001473 Ga0105249_1000147312 135
32 3300014325 Ga0163163_12465966 Ga0163163_124659661 135
33 3300014968 Ga0157379_10033259 Ga0157379_100332593 135
34 3300017792 Ga0163161_10294687 Ga0163161_102946873 135
35 3300025903 Ga0207680_10133808 Ga0207680_101338081 135
36 3300025925 Ga0207650_10000161 Ga0207650_1000016158 135
37 3300025941 Ga0207711_10544049 Ga0207711_105440492 135
38 3300025961 Ga0207712_10002142 Ga0207712_100021424 135
39 3300025972 Ga0207668_10000323 Ga0207668_1000032319 135
40 3300025986 Ga0207658_10000988 Ga0207658_1000098815 135
41 3300026035 Ga0207703_10000968 Ga0207703_1000096812 135
42 3300026088 Ga0207641_10455075 Ga0207641_104550752 135
43 3300026095 Ga0207676_10000685 Ga0207676_1000068514 135
44 3300026118 Ga0207675_100081015 Ga0207675_1000810153 135
45 3300028379 Ga0268266_10010699 Ga0268266_100106995 135
46 3300028380 Ga0268265_10002542 Ga0268265_100025425 135
47 3300028381 Ga0268264_10000059 Ga0268264_1000005952 135
48 3300048904 Ga0496101_1205781 Ga0496101_1205781_77_487 135
49 3300003323 rootH1_10068810 rootH1_100688102 136
50 3300005327 Ga0070658_10206274 Ga0070658_102062742 136
51 3300005336 Ga0070680_100272050 Ga0070680_1002720503 136
52 3300005339 Ga0070660_100321380 Ga0070660_1003213801 136
53 3300005344 Ga0070661_100500286 Ga0070661_1005002861 136
54 3300005347 Ga0070668_100000546 Ga0070668_10000054618 136
55 3300005355 Ga0070671_101073777 Ga0070671_1010737772 136
56 3300005366 Ga0070659_100000111 Ga0070659_10000011144 136
57 3300005366 Ga0070659_100002577 Ga0070659_10000257713 136
58 3300005367 Ga0070667_100008914 Ga0070667_1000089143 136
59 3300005439 Ga0070711_101264715 Ga0070711_1012647151 136
60 3300005458 Ga0070681_10088493 Ga0070681_100884933 136
61 3300005530 Ga0070679_100083107 Ga0070679_1000831073 136
62 3300005539 Ga0068853_100083587 Ga0068853_1000835873 136
63 3300005548 Ga0070665_100004370 Ga0070665_1000043702 136
64 3300005548 Ga0070665_100304394 Ga0070665_1003043942 136
65 3300005563 Ga0068855_100117982 Ga0068855_1001179822 136
66 3300005577 Ga0068857_101968539 Ga0068857_1019685391 136
67 3300005618 Ga0068864_102519044 Ga0068864_1025190441 136
68 3300005841 Ga0068863_102197202 Ga0068863_1021972021 136
69 3300005844 Ga0068862_100016747 Ga0068862_1000167473 136
70 3300009093 Ga0105240_10716189 Ga0105240_107161892 136
71 3300009093 Ga0105240_11440657 Ga0105240_114406573 136
72 3300009174 Ga0105241_10561153 Ga0105241_105611532 136
73 3300009545 Ga0105237_10520897 Ga0105237_105208972 136
74 3300009551 Ga0105238_10057694 Ga0105238_100576943 136
75 3300009551 Ga0105238_10414102 Ga0105238_104141022 136
76 3300009551 Ga0105238_10612252 Ga0105238_106122522 136
77 3300009551 Ga0105238_11095091 Ga0105238_110950912 136
78 3300009553 Ga0105249_10141832 Ga0105249_101418322 136
79 3300013102 Ga0157371_10944448 Ga0157371_109444481 136
80 3300013104 Ga0157370_10442860 Ga0157370_104428602 136
81 3300013105 Ga0157369_10675958 Ga0157369_106759582 136
82 3300013296 Ga0157374_10962846 Ga0157374_109628462 136
83 3300013307 Ga0157372_10195078 Ga0157372_101950783 136
84 3300013307 Ga0157372_11413025 Ga0157372_114130252 136
85 3300014969 Ga0157376_11689000 Ga0157376_116890002 136
86 3300021377 Ga0213874_10215524 Ga0213874_102155242 136
87 3300025909 Ga0207705_10123196 Ga0207705_101231963 136
88 3300025912 Ga0207707_10035948 Ga0207707_100359482 136
89 3300025913 Ga0207695_10311688 Ga0207695_103116882 136
90 3300025917 Ga0207660_10146215 Ga0207660_101462152 136
91 3300025919 Ga0207657_10017915 Ga0207657_100179157 136
92 3300025919 Ga0207657_10032016 Ga0207657_100320162 136
93 3300025920 Ga0207649_10303567 Ga0207649_103035673 136
94 3300025921 Ga0207652_10004499 Ga0207652_100044997 136
95 3300025924 Ga0207694_10417741 Ga0207694_104177412 136
96 3300025924 Ga0207694_10639348 Ga0207694_106393482 136
97 3300025932 Ga0207690_10002589 Ga0207690_100025899 136
98 3300025932 Ga0207690_10417805 Ga0207690_104178052 136
99 3300025941 Ga0207711_10306046 Ga0207711_103060461 136
100 3300025949 Ga0207667_10005260 Ga0207667_1000526010 136
101 3300025972 Ga0207668_10000010 Ga0207668_10000010144 136
102 3300025986 Ga0207658_10004212 Ga0207658_100042127 136
103 3300026041 Ga0207639_10245472 Ga0207639_102454722 136
104 3300026078 Ga0207702_10499403 Ga0207702_104994032 136
105 3300026121 Ga0207683_10295262 Ga0207683_102952623 136
106 3300026142 Ga0207698_12169216 Ga0207698_121692162 136
107 3300028379 Ga0268266_10003713 Ga0268266_1000371314 136
108 3300028379 Ga0268266_10948155 Ga0268266_109481552 136
109 3300028380 Ga0268265_10004500 Ga0268265_100045005 136
110 3300028380 Ga0268265_12024020 Ga0268265_120240201 136
111 3300031852 Ga0307410_11095179 Ga0307410_110951792 136
112 3300032004 Ga0307414_10489440 Ga0307414_104894402 136
113 3300037312 Ga0395899_0009522 Ga0395899_0009522_2213_2638 136
114 3300037418 Ga0395900_0000008 Ga0395900_0000008_46499_46924 136
115 3300037418 Ga0395900_0027530 Ga0395900_0027530_700_1113 136
116 3300037418 Ga0395900_0312858 Ga0395900_0312858_354_785 136
117 3300037418 Ga0395900_0464614 Ga0395900_0464614_469_882 136
118 3300037418 Ga0395900_0732581 Ga0395900_0732581_193_606 136
119 3300037466 Ga0395898_0007219 Ga0395898_0007219_1901_2326 136
120 3300037471 Ga0395905_0011963 Ga0395905_0011963_2390_2815 136
121 3300037471 Ga0395905_0025829 Ga0395905_0025829_1146_1574 136
122 3300037471 Ga0395905_0048499 Ga0395905_0048499_2040_2459 136
123 3300037471 Ga0395905_0116660 Ga0395905_0116660_1343_1756 136
124 3300037471 Ga0395905_1033913 Ga0395905_1033913_81_494 136
125 3300037853 Ga0436364_0762577 Ga0436364_0762577_23_436 136
126 3300038443 Ga0395901_0000008 Ga0395901_0000008_433542_433967 136
127 3300038443 Ga0395901_0157781 Ga0395901_0157781_284_697 136
128 3300038443 Ga0395901_0177893 Ga0395901_0177893_946_1359 136
129 3300038443 Ga0395901_0576645 Ga0395901_0576645_429_842 136
130 3300038443 Ga0395901_0808442 Ga0395901_0808442_420_833 136
131 3300039438 Ga0436360_1086655 Ga0436360_1086655_47_460 136
132 3300039450 Ga0436363_0608731 Ga0436363_0608731_347_766 136
133 3300039453 Ga0436362_0130700 Ga0436362_0130700_83_502 136
134 3300044656 Ga0466969_0003262 Ga0466969_0003262_3794_4213 136
135 3300044683 Ga0466965_0537772 Ga0466965_0537772_222_635 136
136 3300044684 Ga0466966_0004348 Ga0466966_0004348_1880_2299 136
137 3300044693 Ga0466961_0006390 Ga0466961_0006390_641_1060 136
138 3300044694 Ga0466963_0159301 Ga0466963_0159301_586_1005 136
139 3300044719 Ga0466971_0001280 Ga0466971_0001280_5277_5696 136
140 3300044765 Ga0466970_0006429 Ga0466970_0006429_1616_2035 136
141 3300044842 Ga0466957_0041607 Ga0466957_0041607_523_942 136
142 3300044842 Ga0466957_0479831 Ga0466957_0479831_349_762 136
143 3300045049 Ga0466959_0009958 Ga0466959_0009958_1167_1586 136
144 3300045836 Ga0466958_0002312 Ga0466958_0002312_5121_5540 136
145 3300045976 Ga0466967_1198145 Ga0466967_1198145_327_740 136
146 3300046616 Ga0495668_0061179 Ga0495668_0061179_971_1384 136
147 3300046648 Ga0495611_0006190 Ga0495611_0006190_4651_5064 136
148 3300047445 Ga0495677_0207797 Ga0495677_0207797_184_597 136
149 3300048910 Ga0496107_0727459 Ga0496107_0727459_251_664 136
150 3300049569 Ga0501032_0625918 Ga0501032_0625918_184_597 136
151 3300049571 Ga0501034_0192300 Ga0501034_0192300_645_1058 136
152 3300049581 Ga0501047_0578049 Ga0501047_0578049_235_648 136
153 3300049822 Ga0501035_0666702 Ga0501035_0666702_177_590 136
154 3300049822 Ga0501035_1070079 Ga0501035_1070079_103_516 136
155 3300049823 Ga0501044_0017012 Ga0501044_0017012_2750_3163 136
156 3300049823 Ga0501044_0157864 Ga0501044_0157864_79_492 136
157 3300053087 Ga0500643_028015 Ga0500643_028015_247_660 136
158 3300061719 Ga0466962_0002154 Ga0466962_0002154_1044_1463 136
159 3300003316 rootH1_10007970 rootH1_100079701 138
160 3300003323 rootH1_10253678 rootH1_102536781 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

31

103

0.95

Feature Viewer

pLDDT pTM Quality
63.34 0.33 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map