F235389

General Info

Members Datasets Scaffolds Average Seq Length
160 129 320 268

Family's Representative Sequence

Representative Sequence 3300046531|Ga0495665_0020362|Ga0495665_0020362_2117_3004
Length 295
Sequence LPAAVLSTFPEKSSKMGTTPNREGILVFIPAYNCARQIGRTLLQLKGCEAHFREVIVVDNRSTDDTVKSAISAAAQLDLPVRVMQNWDNLGLGGSHKSAFAYAAREGFDYLVVLHGDDQGSIRDLLPHIERGEHRTVDCLLGARFMPGSRLEGYSAFRTFGNEVFNLLFSAASGKRLYDLGSGLNMYRVDAVRNLRYQGFADNLTFNYYMILATVWRRWKIRFFPISWREDDQVSNVKLTRQSLQVLKLLTTFVFRRRDFLDGQHTTRSPDDYRFDTVYDSTLSTQPSGQPDVPR

Samples

Sample ID Description Type Environment
1 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
73 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
92 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
95 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
96 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
107 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
108 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
118 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
119 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
120 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
121 2671180694 Paenibacillus sp. A3 Isolate Unclassified
122 2738541297 Duganella sp. GV083 Isolate Unclassified
123 2821131069 Duganella sp. 1224 Isolate Unclassified
124 2854911287 Brucella lupini LUP21 Isolate Unclassified
125 2857558681 Duganella sp. R-74565 Isolate Unclassified
126 2858950400 Achromobacter sp. K91 Isolate Unclassified
127 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
128 2919476304 Duganella sp. 3397 Isolate Unclassified
129 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.75
Metatranscriptomes 0
Isolates 6.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 0
Rhizoplane 2.5
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495665_0020362 3300046531 Bacteria 3563
2 JGI24739J22299_10003174 3300001989 Bacteria 6276
3 JGI25158J39367_1000046 3300002739 Bacteria 27859
4 JGI25159J45721_1000145 3300002987 Bacteria 32623
5 rootH1_10064463 3300003316 Bacteria 13774
6 rootL2_10380832 3300003322 Unclassified 1808
7 JGI25160J50197_1000327 3300003354 Bacteria 32616
8 JGI25161J50226_1000245 3300003374 Bacteria 32623
9 Ga0055529_1008285 3300003763 Unclassified 1386
10 Ga0055534_1001357 3300003784 Bacteria 9807
11 Ga0055530_10003517 3300003791 Bacteria 8852
12 Ga0055543_1000325 3300004625 Bacteria 32876
13 Ga0065165_1001062 3300005262 Bacteria 32876
14 Ga0070683_100320773 3300005329 Bacteria 1474
15 Ga0070670_100006263 3300005331 Bacteria 10073
16 Ga0070670_100093165 3300005331 Unclassified 2591
17 Ga0070660_100004646 3300005339 Bacteria 9507
18 Ga0070660_100107695 3300005339 Bacteria 2215
19 Ga0070661_100017673 3300005344 Bacteria 5061
20 Ga0070661_100020224 3300005344 Bacteria 4745
21 Ga0070668_100000021 3300005347 Bacteria 96397
22 Ga0070668_100026369 3300005347 Unclassified 4410
23 Ga0070669_100098885 3300005353 Bacteria 2198
24 Ga0070675_100013580 3300005354 Bacteria 6404
25 Ga0070675_100482596 3300005354 Unclassified 1115
26 Ga0070671_100000114 3300005355 Bacteria 51983
27 Ga0070673_100025018 3300005364 Bacteria 4386
28 Ga0070673_100063661 3300005364 Bacteria 2935
29 Ga0070673_100513547 3300005364 Bacteria 1085
30 Ga0070659_100009560 3300005366 Bacteria 7125
31 Ga0070659_100014968 3300005366 Bacteria 5802
32 Ga0070667_100017399 3300005367 Bacteria 5957
33 Ga0070667_100229704 3300005367 Bacteria 1654
34 Ga0070684_100169319 3300005535 Bacteria 1984
35 Ga0070665_100175984 3300005548 Bacteria 2140
36 Ga0070665_100211817 3300005548 Bacteria 1939
37 Ga0070664_100006537 3300005564 Bacteria 9400
38 Ga0070664_100009895 3300005564 Bacteria 7727
39 Ga0068857_100001543 3300005577 Bacteria 18432
40 Ga0068854_100137301 3300005578 Bacteria 1873
41 Ga0068852_100088277 3300005616 Bacteria 2769
42 Ga0068859_100036644 3300005617 Bacteria 4924
43 Ga0068863_100000043 3300005841 Bacteria 153935
44 Ga0068863_100009117 3300005841 Bacteria 9690
45 Ga0068860_100018469 3300005843 Bacteria 6782
46 Ga0068862_100063607 3300005844 Bacteria 3175
47 Ga0097620_100036644 3300006931 Bacteria 4924
48 Ga0111539_10036975 3300009094 Bacteria 5899
49 Ga0114129_10002970 3300009147 Bacteria 23739
50 Ga0105242_10560153 3300009176 Unclassified 1097
51 Ga0105249_10087531 3300009553 Bacteria 2906
52 Ga0157373_10012545 3300013100 Bacteria 6230
53 Ga0157371_10000001 3300013102 Bacteria 1162285
54 Ga0157371_10007625 3300013102 Bacteria 8730
55 Ga0157371_10018163 3300013102 Bacteria 5208
56 Ga0157369_10010173 3300013105 Bacteria 10735
57 Ga0157372_10122710 3300013307 Bacteria 2986
58 Ga0157379_10273405 3300014968 Bacteria 1536
59 Ga0209436_100135 3300025208 Bacteria 36415
60 Ga0209148_1001024 3300025254 Bacteria 17564
61 Ga0209455_1000370 3300025272 Bacteria 41453
62 Ga0209130_1000574 3300025284 Bacteria 35904
63 Ga0209675_1000389 3300025291 Bacteria 36614
64 Ga0209050_1001946 3300025298 Bacteria 19596
65 Ga0207426_1000657 3300025302 Bacteria 42328
66 Ga0207647_10007636 3300025904 Bacteria 7795
67 Ga0207657_10002379 3300025919 Bacteria 20353
68 Ga0207649_10001930 3300025920 Bacteria 11825
69 Ga0207649_10092281 3300025920 Bacteria 1985
70 Ga0207650_10013660 3300025925 Bacteria 5628
71 Ga0207659_10014084 3300025926 Bacteria 5149
72 Ga0207644_10000077 3300025931 Bacteria 72394
73 Ga0207690_10018454 3300025932 Bacteria 4278
74 Ga0207690_10023341 3300025932 Bacteria 3859
75 Ga0207706_10010913 3300025933 Bacteria 8289
76 Ga0207679_10002011 3300025945 Bacteria 12619
77 Ga0207679_10216762 3300025945 Bacteria 1608
78 Ga0207651_10070060 3300025960 Bacteria 2479
79 Ga0207651_10092687 3300025960 Bacteria 2216
80 Ga0207651_10551408 3300025960 Unclassified 1002
81 Ga0207668_10000068 3300025972 Bacteria 81202
82 Ga0207668_10075618 3300025972 Unclassified 2422
83 Ga0207640_10163935 3300025981 Bacteria 1648
84 Ga0207658_10072097 3300025986 Bacteria 2617
85 Ga0207641_10000031 3300026088 Bacteria 224320
86 Ga0207641_10072787 3300026088 Bacteria 2960
87 Ga0207674_10061994 3300026116 Bacteria 3777
88 Ga0207428_10084065 3300027907 Bacteria 2481
89 Ga0268266_10165768 3300028379 Bacteria 2002
90 Ga0268265_10072103 3300028380 Bacteria 2693
91 Ga0268264_10002853 3300028381 Bacteria 15068
92 Ga0265338_10051277 3300028800 Bacteria 3717
93 Ga0307511_10000013 3300030521 Bacteria 127687
94 Ga0265331_10041412 3300031250 Bacteria 2238
95 Ga0265316_10001854 3300031344 Bacteria 22239
96 Ga0307513_10002009 3300031456 Bacteria 28694
97 Ga0307408_100005091 3300031548 Bacteria 8819
98 Ga0307412_10000861 3300031911 Bacteria 17469
99 Ga0307415_100119345 3300032126 Bacteria 1974
100 Ga0395899_0020786 3300037312 Bacteria 4977
101 Ga0395900_0013913 3300037418 Bacteria 8211
102 Ga0395905_0000483 3300037471 Bacteria 54915
103 Ga0395905_0013558 3300037471 Bacteria 7809
104 Ga0436364_0042201 3300037853 Unclassified 1513
105 Ga0395901_0008344 3300038443 Bacteria 10471
106 Ga0439432_001864 3300042006 Bacteria 7922
107 Ga0453684_0002258 3300044712 Bacteria 47714
108 Ga0495638_0031543 3300046460 Bacteria 3405
109 Ga0495650_0014811 3300046471 Bacteria 4031
110 Ga0495606_0002799 3300046507 Bacteria 19441
111 Ga0495606_0024400 3300046507 Bacteria 4357
112 Ga0495610_0009225 3300046512 Bacteria 6260
113 Ga0495628_0127819 3300046516 Bacteria 1946
114 Ga0495643_0026366 3300046522 Bacteria 3280
115 Ga0495663_0031212 3300046525 Unclassified 1582
116 Ga0495654_0026417 3300046530 Bacteria 2984
117 Ga0495633_0005136 3300046558 Bacteria 8116
118 Ga0495668_0000370 3300046616 Bacteria 59498
119 Ga0495668_0037204 3300046616 Bacteria 2723
120 Ga0495669_0000002 3300046684 Bacteria 282777
121 Ga0495669_0000276 3300046684 Bacteria 29327
122 Ga0495669_0004347 3300046684 Bacteria 5849
123 Ga0495669_0081304 3300046684 Bacteria 1487
124 Ga0495670_0011891 3300046691 Bacteria 4282
125 Ga0495671_0003509 3300046692 Bacteria 9614
126 Ga0495674_0083338 3300047319 Bacteria 2741
127 Ga0495672_0181305 3300047320 Bacteria 1066
128 Ga0495683_0001494 3300047323 Bacteria 15253
129 Ga0495683_0044714 3300047323 Bacteria 2227
130 Ga0495602_0108500 3300048088 Bacteria 2260
131 Ga0496106_0251155 3300048909 Unclassified 1414
132 Ga0496108_0000297 3300048911 Bacteria 42741
133 Ga0496108_0387283 3300048911 Bacteria 1221
134 Ga0496116_0008288 3300048919 Bacteria 9035
135 Ga0496118_0012524 3300048921 Bacteria 8128
136 Ga0496119_0000429 3300048922 Bacteria 57809
137 Ga0496120_0000269 3300048923 Bacteria 86896
138 Ga0496120_0000369 3300048923 Bacteria 73307
139 Ga0496124_0042432 3300048927 Bacteria 3918
140 Ga0496126_0005402 3300048929 Bacteria 14587
141 Ga0496126_0208786 3300048929 Bacteria 1645
142 Ga0495678_054805 3300049459 Bacteria 1525
143 Ga0501033_0243538 3300049570 Unclassified 1275
144 Ga0501038_0450795 3300049574 Unclassified 989
145 nmdc:mga00v17_197691_c2 3300050491 Unclassified 959
146 nmdc:mga05p37_21331_c1 3300050507 Bacteria 7843
147 nmdc:mga08y16_83357_c1 3300050511 Bacteria 3332
148 Ga0500641_0005617 3300053096 Bacteria 4445
149 Ga0500586_001605 3300053145 Bacteria 4837
150 Ga0500645_003762 3300053730 Bacteria 6049
151 2608670585 2608642108 Bacteria 4104624
152 2673819529 2671180694 Bacteria 7506943
153 2738825376 2738541297 Bacteria 6549566
154 2821133973 2821131069 Bacteria 6108407
155 2854914453 2854911287 Bacteria 5582813
156 2857564334 2857558681 Bacteria 6617694
157 2858954232 2858950400 Bacteria 6783797
158 2894819122 2894817345 Bacteria 4892941
159 2919481002 2919476304 Bacteria 5888696
160 8021625234 8021622325 Bacteria 4844743
161 Ga0495665_0020362
162 JGI24739J22299_10003174
163 JGI25158J39367_1000046
164 JGI25159J45721_1000145
165 rootH1_10064463
166 rootL2_10380832
167 JGI25160J50197_1000327
168 JGI25161J50226_1000245
169 Ga0055529_1008285
170 Ga0055534_1001357
171 Ga0055530_10003517
172 Ga0055543_1000325
173 Ga0065165_1001062
174 Ga0070683_100320773
175 Ga0070670_100006263
176 Ga0070670_100093165
177 Ga0070660_100004646
178 Ga0070660_100107695
179 Ga0070661_100017673
180 Ga0070661_100020224
181 Ga0070668_100000021
182 Ga0070668_100026369
183 Ga0070669_100098885
184 Ga0070675_100013580
185 Ga0070675_100482596
186 Ga0070671_100000114
187 Ga0070673_100025018
188 Ga0070673_100063661
189 Ga0070673_100513547
190 Ga0070659_100009560
191 Ga0070659_100014968
192 Ga0070667_100017399
193 Ga0070667_100229704
194 Ga0070684_100169319
195 Ga0070665_100175984
196 Ga0070665_100211817
197 Ga0070664_100006537
198 Ga0070664_100009895
199 Ga0068857_100001543
200 Ga0068854_100137301
201 Ga0068852_100088277
202 Ga0068859_100036644
203 Ga0068863_100000043
204 Ga0068863_100009117
205 Ga0068860_100018469
206 Ga0068862_100063607
207 Ga0097620_100036644
208 Ga0111539_10036975
209 Ga0114129_10002970
210 Ga0105242_10560153
211 Ga0105249_10087531
212 Ga0157373_10012545
213 Ga0157371_10000001
214 Ga0157371_10007625
215 Ga0157371_10018163
216 Ga0157369_10010173
217 Ga0157372_10122710
218 Ga0157379_10273405
219 Ga0209436_100135
220 Ga0209148_1001024
221 Ga0209455_1000370
222 Ga0209130_1000574
223 Ga0209675_1000389
224 Ga0209050_1001946
225 Ga0207426_1000657
226 Ga0207647_10007636
227 Ga0207657_10002379
228 Ga0207649_10001930
229 Ga0207649_10092281
230 Ga0207650_10013660
231 Ga0207659_10014084
232 Ga0207644_10000077
233 Ga0207690_10018454
234 Ga0207690_10023341
235 Ga0207706_10010913
236 Ga0207679_10002011
237 Ga0207679_10216762
238 Ga0207651_10070060
239 Ga0207651_10092687
240 Ga0207651_10551408
241 Ga0207668_10000068
242 Ga0207668_10075618
243 Ga0207640_10163935
244 Ga0207658_10072097
245 Ga0207641_10000031
246 Ga0207641_10072787
247 Ga0207674_10061994
248 Ga0207428_10084065
249 Ga0268266_10165768
250 Ga0268265_10072103
251 Ga0268264_10002853
252 Ga0265338_10051277
253 Ga0307511_10000013
254 Ga0265331_10041412
255 Ga0265316_10001854
256 Ga0307513_10002009
257 Ga0307408_100005091
258 Ga0307412_10000861
259 Ga0307415_100119345
260 Ga0395899_0020786
261 Ga0395900_0013913
262 Ga0395905_0000483
263 Ga0395905_0013558
264 Ga0436364_0042201
265 Ga0395901_0008344
266 Ga0439432_001864
267 Ga0453684_0002258
268 Ga0495638_0031543
269 Ga0495650_0014811
270 Ga0495606_0002799
271 Ga0495606_0024400
272 Ga0495610_0009225
273 Ga0495628_0127819
274 Ga0495643_0026366
275 Ga0495663_0031212
276 Ga0495654_0026417
277 Ga0495633_0005136
278 Ga0495668_0000370
279 Ga0495668_0037204
280 Ga0495669_0000002
281 Ga0495669_0000276
282 Ga0495669_0004347
283 Ga0495669_0081304
284 Ga0495670_0011891
285 Ga0495671_0003509
286 Ga0495674_0083338
287 Ga0495672_0181305
288 Ga0495683_0001494
289 Ga0495683_0044714
290 Ga0495602_0108500
291 Ga0496106_0251155
292 Ga0496108_0000297
293 Ga0496108_0387283
294 Ga0496116_0008288
295 Ga0496118_0012524
296 Ga0496119_0000429
297 Ga0496120_0000269
298 Ga0496120_0000369
299 Ga0496124_0042432
300 Ga0496126_0005402
301 Ga0496126_0208786
302 Ga0495678_054805
303 Ga0501033_0243538
304 Ga0501038_0450795
305 nmdc:mga00v17_197691_c2
306 nmdc:mga05p37_21331_c1
307 nmdc:mga08y16_83357_c1
308 Ga0500641_0005617
309 Ga0500586_001605
310 Ga0500645_003762
311 2608670585
312 2673819529
313 2738825376
314 2821133973
315 2854914453
316 2857564334
317 2858954232
318 2894819122
319 2919481002
320 8021625234

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

26

196

0.87

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

20

243

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7947 5 235
2y4j-assembly1.cif.gz_B mannosylglycerate synthase in complex with lactate 0.7387 6 236
5jqx-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with phosphoglyceric acid (pga) - gpgs*pga 0.7377 4 236
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7274 1 235
4y6n-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-1 0.725 4 236
ID Description Score Start End Superfamily
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8341 8 237 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8247 4 227 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8208 8 237 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8155 1 229 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8114 3 241 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A5B8D337-F1-model_v4 deleted 0.9633 4 261
AF-A0A1Y2K6I4-F1-model_v4 Putative family 2 glycosyl transferase 0.9555 3 261 GO:0006487
GO:0016740
AF-A0A0M1JK62-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9546 3 261
AF-A0A5B8D337-F1-model_v4 deleted 0.9489 4 261
AF-A0A329E575-F1-model_v4 Glycosyl transferase family 2 0.9487 4 261 GO:0006487
GO:0016757

Map