F235161

General Info

Members Datasets Scaffolds Average Seq Length
160 114 320 124

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0729991|Ga0436363_0729991_263_709
Length 148
Sequence MRRALERNAHREQGEPLMDEDIKVLERIYDRFNARDIDGVLIALADDVVWANGMDGGHVHGREAIRAYWTRQWSMVSPHVEPVGFHRTADDTIVAEVRQTIRDLEGKSLQGPTHGLKDKMVGHVFRLRDGKVARFDIQDAAKLIYRSQ

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
22 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
25 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
26 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
27 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
39 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
40 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
43 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
44 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
45 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
46 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
47 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
48 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
49 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
55 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
56 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
57 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
58 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
59 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
60 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
61 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
62 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
63 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
66 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
67 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
68 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
69 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
70 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
75 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
78 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
79 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
80 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
81 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
82 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
83 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
84 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
85 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
86 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
87 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
89 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
90 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
91 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
92 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
93 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
96 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
97 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
98 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
99 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
100 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
101 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
102 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
103 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
104 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
105 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
106 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
107 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
108 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
109 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
110 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
111 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
112 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
113 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
114 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.5
Metatranscriptomes 0
Isolates 2.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.62
Nodule 0.62
Rhizoplane 6.25
Rhizosphere 49.38
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0729991 3300039450 Unclassified 862
2 Ga0055526_1005308 3300003771 Bacteria 7463
3 Ga0055528_1000100 3300003790 Bacteria 68303
4 Ga0068868_100140622 3300005338 Unclassified 1981
5 Ga0068868_101811193 3300005338 Bacteria 577
6 Ga0070675_100898822 3300005354 Bacteria 812
7 Ga0070673_100963577 3300005364 Bacteria 793
8 Ga0070667_100593857 3300005367 Bacteria 1020
9 Ga0070709_11351849 3300005434 Bacteria 576
10 Ga0070696_100299326 3300005546 Unclassified 1231
11 Ga0068856_101022956 3300005614 Bacteria 844
12 Ga0068866_10411790 3300005718 Bacteria 875
13 Ga0068860_100000113 3300005843 Bacteria 130939
14 Ga0068862_100426813 3300005844 Bacteria 1245
15 Ga0070715_10476376 3300006163 Unclassified 710
16 Ga0075367_10355267 3300006178 Bacteria 925
17 Ga0075369_10000839 3300006186 Bacteria 10110
18 Ga0114129_10499253 3300009147 Bacteria 1589
19 Ga0105237_10062105 3300009545 Bacteria 3735
20 Ga0105237_10343354 3300009545 Bacteria 1497
21 Ga0105238_11863092 3300009551 Bacteria 634
22 Ga0105239_10181119 3300010375 Bacteria 2357
23 Ga0105239_10425948 3300010375 Unclassified 1504
24 Ga0157375_10640370 3300013308 Bacteria 1220
25 Ga0157379_11945837 3300014968 Unclassified 580
26 Ga0157376_11619388 3300014969 Bacteria 682
27 Ga0213872_10380314 3300021361 Bacteria 575
28 Ga0213875_10000277 3300021388 Bacteria 50402
29 Ga0209673_1000067 3300025273 Bacteria 249077
30 Ga0209564_1000092 3300025295 Bacteria 249018
31 Ga0209256_1000170 3300025299 Bacteria 130504
32 Ga0207671_10004364 3300025914 Bacteria 13562
33 Ga0207671_10795010 3300025914 Bacteria 750
34 Ga0207659_11638672 3300025926 Bacteria 549
35 Ga0207651_11132644 3300025960 Bacteria 702
36 Ga0268265_10403290 3300028380 Bacteria 1264
37 Ga0268264_10000035 3300028381 Bacteria 398196
38 Ga0307515_10080289 3300028794 Bacteria 4257
39 Ga0307509_10372747 3300031507 Bacteria 1143
40 Ga0307516_10113627 3300031730 Bacteria 2506
41 Ga0307507_10331746 3300033179 Bacteria 908
42 Ga0395898_0008862 3300037466 Bacteria 10602
43 Ga0395905_0120606 3300037471 Bacteria 2465
44 Ga0395905_1215029 3300037471 Bacteria 657
45 Ga0436364_1200640 3300037853 Bacteria 136867
46 Ga0395901_0034889 3300038443 Bacteria 5196
47 Ga0436365_0792981 3300039437 Unclassified 922
48 Ga0436365_1137483 3300039437 Bacteria 5141
49 Ga0436360_1129486 3300039438 Bacteria 1047
50 Ga0436360_1241595 3300039438 Unclassified 820
51 Ga0436361_0001807 3300039447 Bacteria 1388
52 Ga0436361_0131466 3300039447 Bacteria 1229
53 Ga0436361_1079552 3300039447 Bacteria 1471
54 Ga0436363_0186521 3300039450 Bacteria 712
55 Ga0436362_0885089 3300039453 Bacteria 736
56 Ga0436362_1270038 3300039453 Unclassified 674
57 Ga0439465_0210997 3300041413 Bacteria 710
58 Ga0451793_1777026 3300041452 Bacteria 548
59 Ga0451851_0663417 3300041507 Bacteria 555
60 Ga0466969_0005263 3300044656 Bacteria 6891
61 Ga0466969_0214454 3300044656 Bacteria 876
62 Ga0466965_0111349 3300044683 Bacteria 1407
63 Ga0466965_0557656 3300044683 Bacteria 647
64 Ga0466966_0138545 3300044684 Unclassified 1488
65 Ga0466968_0000715 3300044735 Bacteria 11478
66 Ga0466959_0075152 3300045049 Unclassified 2442
67 Ga0466959_0100366 3300045049 Bacteria 2072
68 Ga0495627_000816 3300046453 Bacteria 22782
69 Ga0495590_0433931 3300046457 Bacteria 507
70 Ga0495638_0000347 3300046460 Bacteria 58280
71 Ga0495638_0001026 3300046460 Bacteria 27731
72 Ga0495638_0105856 3300046460 Bacteria 1676
73 Ga0495605_0434077 3300046474 Bacteria 543
74 Ga0495610_0000024 3300046512 Bacteria 304748
75 Ga0495616_0074318 3300046513 Bacteria 1638
76 Ga0495632_0034623 3300046519 Bacteria 2583
77 Ga0495637_0048796 3300046520 Bacteria 1781
78 Ga0495597_0158462 3300046542 Bacteria 925
79 Ga0495668_0000047 3300046616 Bacteria 224140
80 Ga0495668_0023913 3300046616 Bacteria 3478
81 Ga0495634_0809895 3300046642 Bacteria 534
82 Ga0495625_0016193 3300046660 Bacteria 5872
83 Ga0495625_0051156 3300046660 Bacteria 2962
84 Ga0495589_0035084 3300046794 Bacteria 2516
85 Ga0495660_0228874 3300046810 Bacteria 872
86 Ga0495672_0006693 3300047320 Bacteria 8848
87 Ga0495681_0236046 3300047470 Bacteria 728
88 Ga0495686_0000091 3300047472 Bacteria 190563
89 Ga0495686_0009591 3300047472 Bacteria 6958
90 Ga0495686_0076081 3300047472 Bacteria 2057
91 Ga0495686_0170648 3300047472 Bacteria 1265
92 Ga0496100_1534629 3300048903 Bacteria 526
93 Ga0496101_0043324 3300048904 Bacteria 3217
94 Ga0496101_0847416 3300048904 Bacteria 720
95 Ga0496102_0902588 3300048905 Bacteria 805
96 Ga0496106_0001884 3300048909 Bacteria 15715
97 Ga0496106_0491014 3300048909 Bacteria 986
98 Ga0496107_0000109 3300048910 Bacteria 39746
99 Ga0496107_0600457 3300048910 Bacteria 813
100 Ga0496115_1357065 3300048918 Bacteria 527
101 Ga0496116_0186575 3300048919 Bacteria 1103
102 Ga0496117_0023296 3300048920 Bacteria 4941
103 Ga0496117_0037684 3300048920 Bacteria 3598
104 Ga0496117_0076561 3300048920 Bacteria 2218
105 Ga0496117_0085423 3300048920 Bacteria 2054
106 Ga0496118_0000228 3300048921 Bacteria 98198
107 Ga0496118_0001280 3300048921 Bacteria 38482
108 Ga0496118_0001899 3300048921 Bacteria 29780
109 Ga0496119_0040031 3300048922 Bacteria 3004
110 Ga0496119_0104777 3300048922 Bacteria 1581
111 Ga0496119_0214549 3300048922 Bacteria 988
112 Ga0496120_0318042 3300048923 Bacteria 708
113 Ga0496121_0005094 3300048924 Bacteria 17131
114 Ga0496121_0007484 3300048924 Bacteria 13190
115 Ga0496121_0009310 3300048924 Bacteria 11329
116 Ga0496122_0185611 3300048925 Bacteria 1234
117 Ga0496124_0000267 3300048927 Bacteria 101138
118 Ga0496124_0004636 3300048927 Bacteria 15921
119 Ga0496124_0086196 3300048927 Bacteria 2571
120 Ga0496125_0000347 3300048928 Bacteria 87782
121 Ga0496125_0033761 3300048928 Bacteria 4522
122 Ga0496126_0002940 3300048929 Bacteria 22137
123 Ga0496126_0011100 3300048929 Bacteria 9358
124 Ga0496126_0034550 3300048929 Bacteria 4748
125 Ga0496126_0364357 3300048929 Bacteria 1180
126 Ga0501047_1212263 3300049581 Unclassified 568
127 Ga0501238_024989 3300049671 Bacteria 854
128 nmdc:mga06z11_485238_c1 3300050494 Bacteria 748
129 nmdc:mga05p37_540223_c1 3300050507 Bacteria 1329
130 nmdc:mga0n895_347402_c1 3300050512 Bacteria 1502
131 nmdc:mga0sz30_13969_c1 3300050516 Bacteria 3153
132 nmdc:mga0sz30_90643_c2 3300050516 Bacteria 959
133 Ga0495619_0711323 3300053085 Bacteria 683
134 Ga0500578_0000092 3300053086 Bacteria 102206
135 Ga0500651_0040242 3300053093 Bacteria 2944
136 Ga0500650_0346955 3300053098 Bacteria 650
137 Ga0500650_0412268 3300053098 Bacteria 583
138 Ga0500554_008448 3300053102 Bacteria 2420
139 Ga0500556_0004408 3300053104 Bacteria 4008
140 Ga0500594_0000055 3300053118 Bacteria 35289
141 Ga0500594_0145383 3300053118 Bacteria 759
142 Ga0500595_001286 3300053119 Bacteria 13657
143 Ga0500595_002366 3300053119 Bacteria 9421
144 Ga0500608_000213 3300053122 Bacteria 23181
145 Ga0500614_083529 3300053123 Bacteria 897
146 Ga0500658_0011989 3300053134 Bacteria 3196
147 Ga0500559_0001203 3300053136 Bacteria 15400
148 Ga0500577_0000330 3300053142 Bacteria 12272
149 Ga0500577_0021205 3300053142 Bacteria 2137
150 Ga0500588_0360923 3300053146 Unclassified 552
151 Ga0500604_0266118 3300053151 Bacteria 594
152 Ga0500622_0030797 3300053156 Bacteria 2815
153 Ga0500622_0054139 3300053156 Bacteria 2059
154 Ga0500636_0043180 3300053177 Bacteria 2662
155 Ga0500645_001943 3300053730 Bacteria 9801
156 Ga0500645_030160 3300053730 Bacteria 1633
157 2511123596 2510917020 Bacteria 5657507
158 2585149157 2582581279 Bacteria 4980720
159 2885417181 2885409591 Bacteria 9235467
160 8005291368 8005289223 Bacteria 6634003
161 Ga0436363_0729991
162 Ga0055526_1005308
163 Ga0055528_1000100
164 Ga0068868_100140622
165 Ga0068868_101811193
166 Ga0070675_100898822
167 Ga0070673_100963577
168 Ga0070667_100593857
169 Ga0070709_11351849
170 Ga0070696_100299326
171 Ga0068856_101022956
172 Ga0068866_10411790
173 Ga0068860_100000113
174 Ga0068862_100426813
175 Ga0070715_10476376
176 Ga0075367_10355267
177 Ga0075369_10000839
178 Ga0114129_10499253
179 Ga0105237_10062105
180 Ga0105237_10343354
181 Ga0105238_11863092
182 Ga0105239_10181119
183 Ga0105239_10425948
184 Ga0157375_10640370
185 Ga0157379_11945837
186 Ga0157376_11619388
187 Ga0213872_10380314
188 Ga0213875_10000277
189 Ga0209673_1000067
190 Ga0209564_1000092
191 Ga0209256_1000170
192 Ga0207671_10004364
193 Ga0207671_10795010
194 Ga0207659_11638672
195 Ga0207651_11132644
196 Ga0268265_10403290
197 Ga0268264_10000035
198 Ga0307515_10080289
199 Ga0307509_10372747
200 Ga0307516_10113627
201 Ga0307507_10331746
202 Ga0395898_0008862
203 Ga0395905_0120606
204 Ga0395905_1215029
205 Ga0436364_1200640
206 Ga0395901_0034889
207 Ga0436365_0792981
208 Ga0436365_1137483
209 Ga0436360_1129486
210 Ga0436360_1241595
211 Ga0436361_0001807
212 Ga0436361_0131466
213 Ga0436361_1079552
214 Ga0436363_0186521
215 Ga0436362_0885089
216 Ga0436362_1270038
217 Ga0439465_0210997
218 Ga0451793_1777026
219 Ga0451851_0663417
220 Ga0466969_0005263
221 Ga0466969_0214454
222 Ga0466965_0111349
223 Ga0466965_0557656
224 Ga0466966_0138545
225 Ga0466968_0000715
226 Ga0466959_0075152
227 Ga0466959_0100366
228 Ga0495627_000816
229 Ga0495590_0433931
230 Ga0495638_0000347
231 Ga0495638_0001026
232 Ga0495638_0105856
233 Ga0495605_0434077
234 Ga0495610_0000024
235 Ga0495616_0074318
236 Ga0495632_0034623
237 Ga0495637_0048796
238 Ga0495597_0158462
239 Ga0495668_0000047
240 Ga0495668_0023913
241 Ga0495634_0809895
242 Ga0495625_0016193
243 Ga0495625_0051156
244 Ga0495589_0035084
245 Ga0495660_0228874
246 Ga0495672_0006693
247 Ga0495681_0236046
248 Ga0495686_0000091
249 Ga0495686_0009591
250 Ga0495686_0076081
251 Ga0495686_0170648
252 Ga0496100_1534629
253 Ga0496101_0043324
254 Ga0496101_0847416
255 Ga0496102_0902588
256 Ga0496106_0001884
257 Ga0496106_0491014
258 Ga0496107_0000109
259 Ga0496107_0600457
260 Ga0496115_1357065
261 Ga0496116_0186575
262 Ga0496117_0023296
263 Ga0496117_0037684
264 Ga0496117_0076561
265 Ga0496117_0085423
266 Ga0496118_0000228
267 Ga0496118_0001280
268 Ga0496118_0001899
269 Ga0496119_0040031
270 Ga0496119_0104777
271 Ga0496119_0214549
272 Ga0496120_0318042
273 Ga0496121_0005094
274 Ga0496121_0007484
275 Ga0496121_0009310
276 Ga0496122_0185611
277 Ga0496124_0000267
278 Ga0496124_0004636
279 Ga0496124_0086196
280 Ga0496125_0000347
281 Ga0496125_0033761
282 Ga0496126_0002940
283 Ga0496126_0011100
284 Ga0496126_0034550
285 Ga0496126_0364357
286 Ga0501047_1212263
287 Ga0501238_024989
288 nmdc:mga06z11_485238_c1
289 nmdc:mga05p37_540223_c1
290 nmdc:mga0n895_347402_c1
291 nmdc:mga0sz30_13969_c1
292 nmdc:mga0sz30_90643_c2
293 Ga0495619_0711323
294 Ga0500578_0000092
295 Ga0500651_0040242
296 Ga0500650_0346955
297 Ga0500650_0412268
298 Ga0500554_008448
299 Ga0500556_0004408
300 Ga0500594_0000055
301 Ga0500594_0145383
302 Ga0500595_001286
303 Ga0500595_002366
304 Ga0500608_000213
305 Ga0500614_083529
306 Ga0500658_0011989
307 Ga0500559_0001203
308 Ga0500577_0000330
309 Ga0500577_0021205
310 Ga0500588_0360923
311 Ga0500604_0266118
312 Ga0500622_0030797
313 Ga0500622_0054139
314 Ga0500636_0043180
315 Ga0500645_001943
316 Ga0500645_030160
317 2511123596
318 2585149157
319 2885417181
320 8005291368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

25

135

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.9003 6 121
4kvh-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase fold protein hmuk_0747 0.8675 3 124
5cf2-assembly1.cif.gz_B crystal structure of the i80y/l114v/i116v mutant of leh 0.8593 3 120
7xef-assembly1.cif.gz_A crystal structure of the y53f/n55a mutant of leh complexed with (r)-(1-benzyl-3-phenylpyrrolidin-3-yl)methanol 0.8567 1 120
4xbx-assembly1.cif.gz_A crystal structure of the l74f/m78f/l103v/l114v/i116v/f139v/l147v mutant of leh 0.8552 1 120
ID Description Score Start End Superfamily
af_A0A1D8PTM6_487_626_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9051 3 25 1.25.40.10
4u13B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.895 6 121 3.10.450.50
4kvhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8675 3 124 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8637 4 121 3.10.450.50
5jppA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8532 1 120 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2V6THP8-F1-model_v4 Ketosteroid isomerase 0.9804 7 89 GO:0016853
AF-A0A0S2EMA7-F1-model_v4 SnoaL-like domain-containing protein 0.9761 1 124
AF-A0A1T5M325-F1-model_v4 SnoaL-like domain-containing protein 0.9757 3 124
AF-A0A2L2NQ09-F1-model_v4 SnoaL-like domain protein 0.9754 1 123
AF-A0A558BS60-F1-model_v4 Nuclear transport factor 2 family protein 0.9753 1 124

Map