F235118

General Info

Members Datasets Scaffolds Average Seq Length
160 116 142 363

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000747|Ga0395905_0000747_38939_40144
Length 401
Sequence MLSINRNRDRGSDAGLKSLSADRRSPPAAADRESAAAVPSPFREVKRLPSIGVLTFHRCINYGSYWQARCLVDGLRALGADAVLLDHRSERIDRAEWRCALQPLLPERSSPQHRALYAAKTRKFFDAFARLPMSPPFALGEPDTVPDCDLVVVGSDEVWNLKHPWYGGSALFYGQGLQSNRLASYAASFGNSTFAEDRDRPWIDYLRDFDHIAVRDLNSRRIVQDMLGEAPDLVLDPCLQFPGSITAIEAHAPDQPFVAVYGHSFPAWFKTAIRHWADTKVLPLVSIGYGNDWVDHQWIDAGPADFARFMASATAVATNFFHGCVFSLVNGKPFSTVLSSYRSNKISDLMATVGAEDHLAGEATAAEDYDLMLGRPPDLAIAARISALRHSSAVYLNHVLR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
5 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
6 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
7 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
8 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
9 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
10 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
11 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
12 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
13 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
14 2909042592 Labrys sp. LIt4 Isolate Nodule
15 2996887358 Rhizobium sp. R711 Isolate Nodule
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
45 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
81 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
108 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
112 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
114 8005321885 Rhizobium sp. R72 Isolate Nodule
115 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
116 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 0.62
Isolates 11.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.62
Nodule 6.88
Rhizoplane 1.88
Rhizosphere 74.38
Stem 0
Stem Tuber 0.62
Unclassified 15.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000430 3300001990 Bacteria 14388
2 JGI24738J21930_10000568 3300002075 Bacteria 10562
3 rootH1_10079177 3300003316 Bacteria 3130
4 rootH1_10080248 3300003316 Bacteria 3378
5 rootH2_10026000 3300003320 Bacteria 22283
6 rootH2_10086138 3300003320 Bacteria 4844
7 rootL2_10025621 3300003322 Bacteria 29729
8 rootL2_10208645 3300003322 Bacteria 4213
9 rootL2_10244694 3300003322 Bacteria 3926
10 rootH1_10010484 3300003323 Bacteria 11333
11 rootH1_10238548 3300003323 Bacteria 2007
12 Ga0065704_10087042 3300005289 Bacteria 3061
13 Ga0070658_10003424 3300005327 Bacteria 13043
14 Ga0070670_100005185 3300005331 Bacteria 10970
15 Ga0070666_10051396 3300005335 Bacteria 2775
16 Ga0070661_100071033 3300005344 Bacteria 2561
17 Ga0070668_100002501 3300005347 Bacteria 13537
18 Ga0070671_100041578 3300005355 Bacteria 3820
19 Ga0070671_100232621 3300005355 Unclassified 1564
20 Ga0070663_100239573 3300005455 Bacteria 1431
21 Ga0070679_100032052 3300005530 Bacteria 5197
22 Ga0070665_100001031 3300005548 Bacteria 34955
23 Ga0068855_100004157 3300005563 Bacteria 17660
24 Ga0068855_100008988 3300005563 Bacteria 12070
25 Ga0068863_100039823 3300005841 Bacteria 4469
26 Ga0068860_100016839 3300005843 Bacteria 7126
27 Ga0068862_100017182 3300005844 Bacteria 6020
28 Ga0105251_10000231 3300009011 Bacteria 56229
29 Ga0105248_10105139 3300009177 Bacteria 3183
30 Ga0105238_10301665 3300009551 Bacteria 1585
31 Ga0105239_10028786 3300010375 Bacteria 6109
32 Ga0157373_10103154 3300013100 Bacteria 2006
33 Ga0157370_10000377 3300013104 Bacteria 56059
34 Ga0157369_10070770 3300013105 Bacteria 3747
35 Ga0157369_10233102 3300013105 Bacteria 1924
36 Ga0157372_10003768 3300013307 Bacteria 16285
37 Ga0214543_1000005 3300021327 Bacteria 454523
38 Ga0207656_10002322 3300025321 Bacteria 6388
39 Ga0207713_1000951 3300025735 Bacteria 25905
40 Ga0207680_10073813 3300025903 Bacteria 2122
41 Ga0207647_10034888 3300025904 Bacteria 3208
42 Ga0207705_10002874 3300025909 Bacteria 13173
43 Ga0207652_10032774 3300025921 Bacteria 4371
44 Ga0207681_10039518 3300025923 Bacteria 3133
45 Ga0207650_10071285 3300025925 Unclassified 2613
46 Ga0207644_10004138 3300025931 Bacteria 9406
47 Ga0207644_10111846 3300025931 Bacteria 2066
48 Ga0207706_10000720 3300025933 Bacteria 34554
49 Ga0207711_10004956 3300025941 Bacteria 11299
50 Ga0207667_10009095 3300025949 Bacteria 11743
51 Ga0207667_10010125 3300025949 Bacteria 11043
52 Ga0207667_10066697 3300025949 Bacteria 3751
53 Ga0207668_10011006 3300025972 Bacteria 5486
54 Ga0207639_10009218 3300026041 Bacteria 6803
55 Ga0207641_10001645 3300026088 Bacteria 21795
56 Ga0207698_10004147 3300026142 Bacteria 8804
57 Ga0209371_1003451 3300027312 Bacteria 7687
58 Ga0268266_10000125 3300028379 Bacteria 151647
59 Ga0268264_10006624 3300028381 Bacteria 9743
60 Ga0268256_1000975 3300030500 Bacteria 19435
61 Ga0307408_100000134 3300031548 Bacteria 82703
62 Ga0307408_100073902 3300031548 Bacteria 2528
63 Ga0307408_100085772 3300031548 Bacteria 2365
64 Ga0307405_10000157 3300031731 Bacteria 26000
65 Ga0307405_10064859 3300031731 Bacteria 2323
66 Ga0307405_10123949 3300031731 Bacteria 1773
67 Ga0307413_10003349 3300031824 Bacteria 6732
68 Ga0307413_10184082 3300031824 Bacteria 1492
69 Ga0307410_10001278 3300031852 Bacteria 11192
70 Ga0307410_10068362 3300031852 Bacteria 2453
71 Ga0307410_10228488 3300031852 Bacteria 1435
72 Ga0307406_10051304 3300031901 Bacteria 2618
73 Ga0307406_10119360 3300031901 Bacteria 1830
74 Ga0307406_10138455 3300031901 Bacteria 1719
75 Ga0307406_10297841 3300031901 Unclassified 1238
76 Ga0307407_10078724 3300031903 Bacteria 1987
77 Ga0307407_10203408 3300031903 Bacteria 1328
78 Ga0307412_10005070 3300031911 Bacteria 7364
79 Ga0307412_10058008 3300031911 Bacteria 2587
80 Ga0307412_10081405 3300031911 Bacteria 2239
81 Ga0307409_100035418 3300031995 Bacteria 3657
82 Ga0307409_100053484 3300031995 Bacteria 3102
83 Ga0307416_100008482 3300032002 Bacteria 6636
84 Ga0307414_10000469 3300032004 Bacteria 21145
85 Ga0307414_10283422 3300032004 Bacteria 1393
86 Ga0307414_10344705 3300032004 Bacteria 1276
87 Ga0307411_10060491 3300032005 Bacteria 2516
88 Ga0307411_10117079 3300032005 Bacteria 1919
89 Ga0307415_100107057 3300032126 Bacteria 2065
90 Ga0395900_0174274 3300037418 Bacteria 2188
91 Ga0395900_0193304 3300037418 Bacteria 2063
92 Ga0395898_0126065 3300037466 Bacteria 2453
93 Ga0395905_0000747 3300037471 Bacteria 42856
94 Ga0395905_0001360 3300037471 Bacteria 29774
95 Ga0395905_0004372 3300037471 Bacteria 14709
96 Ga0395905_0062745 3300037471 Bacteria 3476
97 Ga0395901_0030800 3300038443 Bacteria 5528
98 Ga0395901_0261696 3300038443 Bacteria 1800
99 Ga0466972_0002035 3300044658 Bacteria 9904
100 Ga0453683_0001153 3300044673 Bacteria 23986
101 Ga0466966_0061347 3300044684 Bacteria 2372
102 Ga0466966_0113114 3300044684 Bacteria 1672
103 Ga0466963_0003338 3300044694 Bacteria 9157
104 Ga0466964_0002247 3300044706 Bacteria 6848
105 Ga0466968_0056635 3300044735 Bacteria 1684
106 Ga0466970_0000165 3300044765 Bacteria 31613
107 Ga0466970_0142552 3300044765 Bacteria 1320
108 Ga0466957_0017244 3300044842 Bacteria 4227
109 Ga0466957_0025621 3300044842 Bacteria 3496
110 Ga0466957_0040235 3300044842 Bacteria 2823
111 Ga0466957_0067422 3300044842 Bacteria 2208
112 Ga0466960_0009727 3300044901 Bacteria 3975
113 Ga0451576_0026874 3300045051 Bacteria 6184
114 Ga0466958_0017170 3300045836 Bacteria 4179
115 Ga0466967_0092432 3300045976 Bacteria 2751
116 Ga0466967_0190540 3300045976 Bacteria 1938
117 Ga0466967_0340707 3300045976 Bacteria 1450
118 Ga0496103_0159301 3300048906 Bacteria 1447
119 Ga0496108_0220140 3300048911 Unclassified 1649
120 Ga0496113_0017539 3300048916 Bacteria 4971
121 Ga0496116_0044504 3300048919 Bacteria 3014
122 Ga0496116_0117162 3300048919 Viruses 1551
123 Ga0496117_0047572 3300048920 Bacteria 3074
124 Ga0496117_0062134 3300048920 Bacteria 2561
125 Ga0496118_0066164 3300048921 Bacteria 2639
126 Ga0496119_0079037 3300048922 Bacteria 1901
127 Ga0496121_0003144 3300048924 Bacteria 23828
128 Ga0496122_0067356 3300048925 Bacteria 2580
129 Ga0496124_0074599 3300048927 Unclassified 2804
130 Ga0496125_0023018 3300048928 Bacteria 5767
131 Ga0496125_0037777 3300048928 Bacteria 4193
132 Ga0496126_0134439 3300048929 Bacteria 2134
133 Ga0501033_0128023 3300049570 Bacteria 1841
134 Ga0501046_0276315 3300049580 Bacteria 1231
135 Ga0501235_003386 3300049669 Bacteria 3450
136 Ga0501225_0002896 3300049705 Bacteria 5268
137 Ga0501225_0010740 3300049705 Bacteria 2590
138 Ga0501044_0275115 3300049823 Bacteria 1619
139 Ga0501045_0291052 3300049824 Bacteria 1215
140 Ga0500556_0000207 3300053104 Bacteria 48431
141 Ga0587088_002155 3300059508 Bacteria 2187
142 Ga0466962_0074663 3300061719 Bacteria 1620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0061347 Ga0466966_0061347_1346_2332 326
2 3300045976 Ga0466967_0340707 Ga0466967_0340707_125_1111 326
3 3300032004 Ga0307414_10344705 Ga0307414_103447052 339
4 3300031548 Ga0307408_100085772 Ga0307408_1000857722 340
5 3300031731 Ga0307405_10064859 Ga0307405_100648592 340
6 3300031901 Ga0307406_10119360 Ga0307406_101193602 340
7 3300032002 Ga0307416_100008482 Ga0307416_1000084827 340
8 3300032005 Ga0307411_10117079 Ga0307411_101170792 340
9 3300037418 Ga0395900_0174274 Ga0395900_0174274_900_1952 340
10 3300037466 Ga0395898_0126065 Ga0395898_0126065_350_1423 343
11 3300038443 Ga0395901_0261696 Ga0395901_0261696_56_1129 343
12 3300031901 Ga0307406_10138455 Ga0307406_101384552 346
13 3300031911 Ga0307412_10081405 Ga0307412_100814052 346
14 3300032004 Ga0307414_10283422 Ga0307414_102834222 346
15 3300032126 Ga0307415_100107057 Ga0307415_1001070572 346
16 iso_pu_bacteria 2802429268 2804755132 346
17 iso_pu_bacteria 2855020534 2855020711 346
18 3300031548 Ga0307408_100073902 Ga0307408_1000739021 347
19 3300048922 Ga0496119_0079037 Ga0496119_0079037_826_1875 348
20 iso_pu_bacteria 2508501122 2509110502 349
21 iso_pu_bacteria 2509276019 2509377156 349
22 iso_pu_bacteria 2558860100 2558862319 349
23 iso_pu_bacteria 2657244999 2657685625 349
24 iso_pu_bacteria 2850079185 2850085295 349
25 iso_pu_bacteria 8049293176 8049298169 349
26 3300005355 Ga0070671_100041578 Ga0070671_1000415781 350
27 3300048920 Ga0496117_0047572 Ga0496117_0047572_1848_2942 350
28 iso_pu_bacteria 2909042592 2909047634 350
29 3300003316 rootH1_10079177 rootH1_100791772 352
30 3300031901 Ga0307406_10297841 Ga0307406_102978411 352
31 3300037471 Ga0395905_0001360 Ga0395905_0001360_18333_19436 352
32 3300037471 Ga0395905_0004372 Ga0395905_0004372_4752_5819 352
33 3300044658 Ga0466972_0002035 Ga0466972_0002035_6552_7613 352
34 3300044684 Ga0466966_0113114 Ga0466966_0113114_222_1283 352
35 3300044706 Ga0466964_0002247 Ga0466964_0002247_370_1431 352
36 3300044735 Ga0466968_0056635 Ga0466968_0056635_525_1586 352
37 3300044765 Ga0466970_0142552 Ga0466970_0142552_137_1198 352
38 3300044901 Ga0466960_0009727 Ga0466960_0009727_2836_3897 352
39 3300045836 Ga0466958_0017170 Ga0466958_0017170_2075_3136 352
40 3300053104 Ga0500556_0000207 Ga0500556_0000207_5437_6501 352
41 iso_pu_bacteria 2996887358 2996893207 352
42 iso_pu_bacteria 8005321885 8005327734 352
43 3300003322 rootL2_10208645 rootL2_102086453 353
44 3300005563 Ga0068855_100008988 Ga0068855_1000089882 353
45 3300021327 Ga0214543_1000005 Ga0214543_1000005325 353
46 3300025949 Ga0207667_10010125 Ga0207667_1001012511 353
47 3300031824 Ga0307413_10184082 Ga0307413_101840821 353
48 3300031852 Ga0307410_10068362 Ga0307410_100683622 353
49 3300031852 Ga0307410_10228488 Ga0307410_102284882 353
50 3300031903 Ga0307407_10078724 Ga0307407_100787242 353
51 3300031903 Ga0307407_10203408 Ga0307407_102034082 353
52 3300031911 Ga0307412_10058008 Ga0307412_100580082 353
53 3300031995 Ga0307409_100053484 Ga0307409_1000534842 353
54 3300032005 Ga0307411_10060491 Ga0307411_100604912 353
55 3300049570 Ga0501033_0128023 Ga0501033_0128023_716_1780 353
56 3300049823 Ga0501044_0275115 Ga0501044_0275115_79_1143 353
57 3300045976 Ga0466967_0190540 Ga0466967_0190540_769_1836 354
58 3300049580 Ga0501046_0276315 Ga0501046_0276315_43_1110 354
59 3300049669 Ga0501235_003386 Ga0501235_003386_1452_2519 354
60 3300049705 Ga0501225_0010740 Ga0501225_0010740_72_1139 354
61 3300049824 Ga0501045_0291052 Ga0501045_0291052_20_1087 354
62 3300003320 rootH2_10086138 rootH2_100861382 355
63 3300005327 Ga0070658_10003424 Ga0070658_100034246 355
64 3300005344 Ga0070661_100071033 Ga0070661_1000710331 355
65 3300005455 Ga0070663_100239573 Ga0070663_1002395731 355
66 3300005530 Ga0070679_100032052 Ga0070679_1000320523 355
67 3300025909 Ga0207705_10002874 Ga0207705_100028746 355
68 3300025921 Ga0207652_10032774 Ga0207652_100327743 355
69 3300037418 Ga0395900_0193304 Ga0395900_0193304_191_1261 355
70 3300037471 Ga0395905_0062745 Ga0395905_0062745_1522_2592 355
71 3300038443 Ga0395901_0030800 Ga0395901_0030800_1016_2086 355
72 3300044842 Ga0466957_0025621 Ga0466957_0025621_110_1180 355
73 3300044842 Ga0466957_0040235 Ga0466957_0040235_1335_2408 355
74 3300044842 Ga0466957_0067422 Ga0466957_0067422_636_1706 355
75 3300045976 Ga0466967_0092432 Ga0466967_0092432_268_1341 355
76 3300005563 Ga0068855_100004157 Ga0068855_1000041574 357
77 3300013105 Ga0157369_10233102 Ga0157369_102331022 357
78 3300025949 Ga0207667_10009095 Ga0207667_100090952 357
79 iso_pu_bacteria 2775507255 2778123466 357
80 iso_pu_bacteria 2899259804 2899261500 357
81 3300003322 rootL2_10244694 rootL2_102446943 360
82 iso_pu_bacteria 2513237088 2513597802 360
83 3300031731 Ga0307405_10123949 Ga0307405_101239493 361
84 3300031911 Ga0307412_10005070 Ga0307412_100050703 361
85 3300044673 Ga0453683_0001153 Ga0453683_0001153_5509_6717 361
86 3300005289 Ga0065704_10087042 Ga0065704_100870422 362
87 3300005331 Ga0070670_100005185 Ga0070670_1000051855 362
88 3300005335 Ga0070666_10051396 Ga0070666_100513962 362
89 3300005347 Ga0070668_100002501 Ga0070668_1000025018 362
90 3300005548 Ga0070665_100001031 Ga0070665_10000103127 362
91 3300005841 Ga0068863_100039823 Ga0068863_1000398233 362
92 3300005843 Ga0068860_100016839 Ga0068860_1000168394 362
93 3300005844 Ga0068862_100017182 Ga0068862_1000171823 362
94 3300009011 Ga0105251_10000231 Ga0105251_1000023126 362
95 3300009177 Ga0105248_10105139 Ga0105248_101051392 362
96 3300025735 Ga0207713_1000951 Ga0207713_100095124 362
97 3300025903 Ga0207680_10073813 Ga0207680_100738132 362
98 3300025923 Ga0207681_10039518 Ga0207681_100395182 362
99 3300025931 Ga0207644_10004138 Ga0207644_100041382 362
100 3300025941 Ga0207711_10004956 Ga0207711_100049566 362
101 3300025972 Ga0207668_10011006 Ga0207668_100110065 362
102 3300026088 Ga0207641_10001645 Ga0207641_1000164516 362
103 3300028379 Ga0268266_10000125 Ga0268266_100001253 362
104 3300028381 Ga0268264_10006624 Ga0268264_100066249 362
105 3300037471 Ga0395905_0000747 Ga0395905_0000747_38939_40144 362
106 3300048906 Ga0496103_0159301 Ga0496103_0159301_16_1119 362
107 3300048919 Ga0496116_0044504 Ga0496116_0044504_1853_2956 362
108 3300048920 Ga0496117_0062134 Ga0496117_0062134_561_1664 362
109 3300048921 Ga0496118_0066164 Ga0496118_0066164_829_1932 362
110 3300048924 Ga0496121_0003144 Ga0496121_0003144_10189_11292 362
111 3300048925 Ga0496122_0067356 Ga0496122_0067356_53_1156 362
112 3300048928 Ga0496125_0037777 Ga0496125_0037777_1007_2110 362
113 3300048929 Ga0496126_0134439 Ga0496126_0134439_336_1439 362
114 3300045051 Ga0451576_0026874 Ga0451576_0026874_2550_3755 364
115 3300049705 Ga0501225_0002896 Ga0501225_0002896_2051_3148 364
116 3300003316 rootH1_10080248 rootH1_100802483 365
117 3300003320 rootH2_10026000 rootH2_1002600010 365
118 3300003322 rootL2_10025621 rootL2_1002562117 365
119 3300003323 rootH1_10010484 rootH1_100104842 365
120 3300003323 rootH1_10238548 rootH1_102385482 365
121 3300005355 Ga0070671_100232621 Ga0070671_1002326211 365
122 3300025925 Ga0207650_10071285 Ga0207650_100712852 365
123 3300025931 Ga0207644_10111846 Ga0207644_101118461 365
124 3300027312 Ga0209371_1003451 Ga0209371_10034516 365
125 3300030500 Ga0268256_1000975 Ga0268256_100097516 365
126 3300044694 Ga0466963_0003338 Ga0466963_0003338_4876_6030 365
127 3300044765 Ga0466970_0000165 Ga0466970_0000165_1127_2281 365
128 3300044842 Ga0466957_0017244 Ga0466957_0017244_989_2143 365
129 3300048911 Ga0496108_0220140 Ga0496108_0220140_359_1459 365
130 3300048916 Ga0496113_0017539 Ga0496113_0017539_3806_4906 365
131 3300048919 Ga0496116_0117162 Ga0496116_0117162_34_1134 365
132 3300048927 Ga0496124_0074599 Ga0496124_0074599_398_1498 365
133 3300048928 Ga0496125_0023018 Ga0496125_0023018_295_1395 365
134 3300059508 Ga0587088_002155 Ga0587088_002155_669_1817 365
135 3300061719 Ga0466962_0074663 Ga0466962_0074663_91_1245 365
136 iso_pu_bacteria 2524023209 2524457439 365
137 iso_pu_bacteria 2818991448 2819610831 365
138 iso_pu_bacteria 2842357229 2842358469 365
139 iso_pu_bacteria 8005645114 8005651478 365
140 3300009551 Ga0105238_10301665 Ga0105238_103016652 371
141 3300010375 Ga0105239_10028786 Ga0105239_100287862 371
142 3300013100 Ga0157373_10103154 Ga0157373_101031542 371
143 3300013104 Ga0157370_10000377 Ga0157370_1000037722 371
144 3300025321 Ga0207656_10002322 Ga0207656_100023227 371
145 3300025904 Ga0207647_10034888 Ga0207647_100348882 371
146 3300025949 Ga0207667_10066697 Ga0207667_100666974 371
147 3300031548 Ga0307408_100000134 Ga0307408_10000013454 371
148 3300031731 Ga0307405_10000157 Ga0307405_100001578 371
149 3300031824 Ga0307413_10003349 Ga0307413_100033496 371
150 3300031852 Ga0307410_10001278 Ga0307410_1000127811 371
151 3300031901 Ga0307406_10051304 Ga0307406_100513043 371
152 3300031995 Ga0307409_100035418 Ga0307409_1000354184 371
153 3300032004 Ga0307414_10000469 Ga0307414_100004694 371
154 3300001990 JGI24737J22298_10000430 JGI24737J22298_100004303 372
155 3300002075 JGI24738J21930_10000568 JGI24738J21930_100005684 372
156 3300013105 Ga0157369_10070770 Ga0157369_100707702 372
157 3300013307 Ga0157372_10003768 Ga0157372_1000376815 372
158 3300025933 Ga0207706_10000720 Ga0207706_1000072038 372
159 3300026041 Ga0207639_10009218 Ga0207639_100092184 372
160 3300026142 Ga0207698_10004147 Ga0207698_100041478 372

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04230

PS_pyruv_trans

Polysaccharide pyruvyl transferase

61

341

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p5z-assembly1.cif.gz_B cobalt-sirohydrochlorin-bound s. typhimurium siroheme synthase 0.6482 221 303
1z73-assembly1.cif.gz_A crystal structure of e. coli arna dehydrogenase (decarboxylase) domain, s433a mutant 0.6441 223 304
1z74-assembly1.cif.gz_A crystal structure of e.coli arna dehydrogenase (decarboxylase) domain, r619y mutant 0.6392 223 304
4kgn-assembly1.cif.gz_B crystal structure of a trna (cytidine(34)-2'-o)-methyltransferase bound to s-adenosyl homocysteine 0.634 224 259
4u7j-assembly1.cif.gz_B-2 crystal structure of argininosuccinate synthase from mycobacterium thermoresistibile 0.6331 223 254
ID Description Score Start End Superfamily
4nesA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6769 222 341 3.40.50.2000
af_I1MQ93_5_170_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.6562 223 285 3.40.50.150
1v4vB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6559 220 306 3.40.50.2000
af_P25742_154_333_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6533 221 304 3.40.50.2000
1o6cB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6459 222 338 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A2M6GJC5-F1-model_v4 Polysaccharide pyruvyl transferase domain-containing protein 0.9788 16 209
AF-A0A1W6D039-F1-model_v4 Polysaccharide pyruvyl transferase 0.9702 19 363 GO:0016740
AF-A0A7W7EJ01-F1-model_v4 Polysaccharide pyruvyl transferase domain-containing protein 0.9638 84 365
AF-A0A520HWJ2-F1-model_v4 Polysaccharide pyruvyl transferase family protein 0.9613 20 146 GO:0016740
AF-J7QSE9-F1-model_v4 Polysaccharide pyruvyl transferase domain-containing protein 0.9604 17 363

Feature Viewer

pLDDT pTM Quality
91.8 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map