F235010

General Info

Members Datasets Scaffolds Average Seq Length
160 99 320 106

Family's Representative Sequence

Representative Sequence 3300032168|Ga0316593_10273304|Ga0316593_102733041
Length 116
Sequence MESGVIDVPKKHPKIRKDDKIIVLTGKEKGKIGTVLKVDPEKERVIIEKVNMVKKHAKASAQTAQGGIIEKEAPLNISDVMIVCNKCAVPTRIGKRVLEDGSKIRVCKKCGEPMDE

Samples

Sample ID Description Type Environment
1 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
5 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
6 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
7 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
8 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
16 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
17 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
45 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
46 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
47 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
48 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
49 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
50 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
53 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
57 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
60 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
65 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
68 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
73 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
74 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
75 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
76 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
82 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
83 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
84 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
85 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
89 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
90 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
91 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
94 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
95 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
96 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
97 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
98 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
99 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.12
Rhizosphere 96.25
Stem 0
Stem Tuber 0
Unclassified 4.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316593_10273304 3300032168 Bacteria 636
2 Ga0065712_10838946 3300005290 Bacteria 501
3 Ga0065707_10144310 3300005295 Bacteria 1732
4 Ga0070694_100126156 3300005444 Bacteria 1843
5 Ga0070697_101447650 3300005536 Bacteria 614
6 Ga0070697_101708379 3300005536 Bacteria 563
7 Ga0070672_100921536 3300005543 Unclassified 772
8 Ga0070686_100360566 3300005544 Bacteria 1095
9 Ga0070695_100008633 3300005545 Bacteria 6053
10 Ga0070695_100149888 3300005545 Bacteria 1627
11 Ga0070695_101077201 3300005545 Bacteria 657
12 Ga0070665_100341897 3300005548 Bacteria 1501
13 Ga0070704_100153257 3300005549 Bacteria 1814
14 Ga0070704_100153762 3300005549 Bacteria 1812
15 Ga0070704_100274380 3300005549 Bacteria 1394
16 Ga0068856_102384254 3300005614 Bacteria 537
17 Ga0068860_100000718 3300005843 Bacteria 37921
18 Ga0081539_10295700 3300005985 Bacteria 698
19 Ga0070717_11764197 3300006028 Bacteria 560
20 Ga0075432_10001101 3300006058 Bacteria 8630
21 Ga0070715_10366481 3300006163 Bacteria 791
22 Ga0097621_101271651 3300006237 Bacteria 694
23 Ga0075428_100010507 3300006844 Bacteria 10286
24 Ga0075428_102329268 3300006844 Bacteria 551
25 Ga0075430_100140725 3300006846 Bacteria 2009
26 Ga0075431_100782804 3300006847 Bacteria 928
27 Ga0075433_10002443 3300006852 Bacteria 14147
28 Ga0075433_10003136 3300006852 Bacteria 12736
29 Ga0075433_10163788 3300006852 Bacteria 1979
30 Ga0075433_10374760 3300006852 Bacteria 1257
31 Ga0075434_100000038 3300006871 Bacteria 59843
32 Ga0075434_100001824 3300006871 Bacteria 18394
33 Ga0075434_100072156 3300006871 Bacteria 3444
34 Ga0075434_100110302 3300006871 Bacteria 2762
35 Ga0075429_100208234 3300006880 Bacteria 1713
36 Ga0075429_100270330 3300006880 Bacteria 1489
37 Ga0075436_100004621 3300006914 Bacteria 9434
38 Ga0075435_100027645 3300007076 Bacteria 4440
39 Ga0075435_100176213 3300007076 Bacteria 1806
40 Ga0075435_101689411 3300007076 Bacteria 556
41 Ga0111539_12266968 3300009094 Bacteria 630
42 Ga0114129_10065627 3300009147 Bacteria 5065
43 Ga0114129_10883783 3300009147 Bacteria 1134
44 Ga0114129_13508227 3300009147 Bacteria 501
45 Ga0105242_11776975 3300009176 Bacteria 654
46 Ga0105248_12421127 3300009177 Bacteria 598
47 Ga0105249_10453381 3300009553 Bacteria 1322
48 Ga0157371_11127545 3300013102 Bacteria 602
49 Ga0157374_10039567 3300013296 Bacteria 4339
50 Ga0157375_10109485 3300013308 Bacteria 2859
51 Ga0157380_10836968 3300014326 Bacteria 941
52 Ga0157379_10000927 3300014968 Bacteria 23696
53 Ga0157379_10307620 3300014968 Bacteria 1445
54 Ga0157376_10534347 3300014969 Bacteria 1158
55 Ga0207691_10812067 3300025940 Unclassified 786
56 Ga0207703_11891628 3300026035 Unclassified 573
57 Ga0207641_10609402 3300026088 Bacteria 1070
58 Ga0268266_10296471 3300028379 Bacteria 1507
59 Ga0268264_10000720 3300028381 Bacteria 37924
60 Ga0265323_10006742 3300028653 Bacteria 4812
61 Ga0265323_10045000 3300028653 Bacteria 1587
62 Ga0265338_10353916 3300028800 Bacteria 1055
63 Ga0265330_10202578 3300031235 Bacteria 839
64 Ga0265320_10175464 3300031240 Bacteria 962
65 Ga0265331_10026117 3300031250 Bacteria 2941
66 Ga0265316_10017518 3300031344 Bacteria 6186
67 Ga0316579_10005033 3300031691 Bacteria 5302
68 Ga0265314_10004534 3300031711 Bacteria 12837
69 Ga0265314_10373543 3300031711 Bacteria 778
70 Ga0265342_10013077 3300031712 Bacteria 5587
71 Ga0265342_10536463 3300031712 Bacteria 594
72 Ga0316576_10155282 3300031727 Bacteria 1725
73 Ga0316576_10159688 3300031727 Unclassified 1700
74 Ga0316576_10899019 3300031727 Unclassified 634
75 Ga0316577_10192970 3300031733 Bacteria 1151
76 Ga0316593_10001783 3300032168 Bacteria 4897
77 Ga0316593_10003721 3300032168 Bacteria 3827
78 Ga0316593_10289817 3300032168 Bacteria 618
79 Ga0316588_1003430 3300033528 Bacteria 2894
80 Ga0316587_1000908 3300033529 Bacteria 3368
81 Ga0316587_1094943 3300033529 Bacteria 571
82 Ga0316596_1239229 3300033541 Bacteria 510
83 Ga0373954_0156125 3300035118 Bacteria 1116
84 Ga0373957_0117503 3300035120 Bacteria 1075
85 Ga0373955_0345873 3300035172 Bacteria 900
86 Ga0316574_0179744 3300035398 Bacteria 1361
87 Ga0316574_0469469 3300035398 Bacteria 787
88 Ga0373933_0720050 3300035724 Bacteria 656
89 Ga0373937_0644155 3300036401 Bacteria 1005
90 Ga0316582_0062308 3300036647 Bacteria 2394
91 Ga0316582_0092586 3300036647 Bacteria 1992
92 Ga0316582_0156009 3300036647 Bacteria 1545
93 Ga0316582_0191959 3300036647 Unclassified 1392
94 Ga0316582_1096967 3300036647 Bacteria 542
95 Ga0316584_0050494 3300036712 Bacteria 3110
96 Ga0316581_0016076 3300037588 Bacteria 2147
97 Ga0451855_0353687 3300041511 Bacteria 579
98 Ga0451577_0018417 3300042876 Bacteria 6433
99 Ga0451577_0090100 3300042876 Bacteria 2737
100 Ga0451577_0317597 3300042876 Bacteria 1412
101 Ga0451577_0677187 3300042876 Bacteria 935
102 Ga0451577_0966403 3300042876 Bacteria 766
103 Ga0439440_0019774 3300042993 Bacteria 1506
104 Ga0453683_0447955 3300044673 Bacteria 835
105 Ga0453684_0007468 3300044712 Bacteria 20074
106 Ga0453684_0042819 3300044712 Bacteria 6096
107 Ga0453684_0111000 3300044712 Bacteria 3332
108 Ga0453684_0116346 3300044712 Bacteria 3238
109 Ga0453684_0128219 3300044712 Bacteria 3049
110 Ga0453684_0235961 3300044712 Bacteria 2108
111 Ga0453684_0278048 3300044712 Bacteria 1910
112 Ga0453684_0623233 3300044712 Bacteria 1180
113 Ga0453684_0753247 3300044712 Unclassified 1054
114 Ga0451576_0005300 3300045051 Bacteria 16207
115 Ga0451576_0063362 3300045051 Bacteria 3853
116 Ga0451576_0470673 3300045051 Bacteria 1320
117 Ga0451576_1140562 3300045051 Bacteria 815
118 Ga0451576_1487654 3300045051 Bacteria 704
119 Ga0451576_2188032 3300045051 Bacteria 568
120 Ga0495580_0001448 3300046472 Bacteria 20804
121 Ga0495676_0102522 3300047321 Bacteria 2114
122 Ga0496104_0036226 3300048907 Bacteria 4612
123 Ga0496105_0213217 3300048908 Bacteria 1573
124 Ga0496106_0895933 3300048909 Bacteria 701
125 Ga0496110_0516950 3300048913 Bacteria 1086
126 Ga0496114_0068408 3300048917 Bacteria 2981
127 Ga0501031_0844072 3300049568 Bacteria 587
128 Ga0501040_0230286 3300049576 Bacteria 1319
129 Ga0501041_0472323 3300049577 Bacteria 797
130 Ga0501071_0145214 3300049587 Bacteria 1768
131 Ga0501072_0692981 3300049588 Bacteria 801
132 Ga0501073_0329080 3300049589 Bacteria 1055
133 Ga0501075_0666371 3300049591 Bacteria 793
134 Ga0501076_0015095 3300049592 Bacteria 5833
135 Ga0501079_0338296 3300049741 Bacteria 1179
136 Ga0501080_0058519 3300049742 Bacteria 3587
137 Ga0501081_0263305 3300049743 Bacteria 1260
138 nmdc:mga05p37_1033115_c1 3300050507 Bacteria 869
139 nmdc:mga05p37_78937_c1 3300050507 Bacteria 4053
140 nmdc:mga09592_247197_c1 3300050508 Bacteria 1546
141 nmdc:mga09592_51122_c1 3300050508 Bacteria 3486
142 nmdc:mga0qj67_26657_c1 3300050509 Bacteria 4474
143 nmdc:mga08y16_525135_c1 3300050511 Bacteria 1200
144 nmdc:mga0n895_112230_c1 3300050512 Bacteria 2743
145 nmdc:mga0n895_32532_c1 3300050512 Bacteria 5007
146 nmdc:mga0n895_56240_c1 3300050512 Bacteria 3875
147 nmdc:mga0n895_8948_c1 3300050512 Bacteria 8729
148 nmdc:mga0rr50_1541632_c1 3300050513 Bacteria 561
149 nmdc:mga0rr50_231716_c1 3300050513 Bacteria 1528
150 nmdc:mga0rr50_4708_c1 3300050513 Bacteria 8045
151 nmdc:mga08x19_14593_c1 3300050514 Bacteria 4766
152 nmdc:mga0a205_263572_c1 3300050515 Bacteria 1601
153 nmdc:mga0a205_290552_c1 3300050515 Bacteria 1509
154 nmdc:mga0a205_390_c1 3300050515 Bacteria 33406
155 nmdc:mga0a205_585128_c1 3300050515 Bacteria 970
156 nmdc:mga0a205_63334_c1 3300050515 Bacteria 3573
157 Ga0501084_0703664 3300054114 Bacteria 852
158 Ga0501084_1372557 3300054114 Bacteria 592
159 Ga0501082_0650476 3300060353 Bacteria 922
160 Ga0530510_0357705 3300061734 Bacteria 1097
161 Ga0316593_10273304
162 Ga0065712_10838946
163 Ga0065707_10144310
164 Ga0070694_100126156
165 Ga0070697_101447650
166 Ga0070697_101708379
167 Ga0070672_100921536
168 Ga0070686_100360566
169 Ga0070695_100008633
170 Ga0070695_100149888
171 Ga0070695_101077201
172 Ga0070665_100341897
173 Ga0070704_100153257
174 Ga0070704_100153762
175 Ga0070704_100274380
176 Ga0068856_102384254
177 Ga0068860_100000718
178 Ga0081539_10295700
179 Ga0070717_11764197
180 Ga0075432_10001101
181 Ga0070715_10366481
182 Ga0097621_101271651
183 Ga0075428_100010507
184 Ga0075428_102329268
185 Ga0075430_100140725
186 Ga0075431_100782804
187 Ga0075433_10002443
188 Ga0075433_10003136
189 Ga0075433_10163788
190 Ga0075433_10374760
191 Ga0075434_100000038
192 Ga0075434_100001824
193 Ga0075434_100072156
194 Ga0075434_100110302
195 Ga0075429_100208234
196 Ga0075429_100270330
197 Ga0075436_100004621
198 Ga0075435_100027645
199 Ga0075435_100176213
200 Ga0075435_101689411
201 Ga0111539_12266968
202 Ga0114129_10065627
203 Ga0114129_10883783
204 Ga0114129_13508227
205 Ga0105242_11776975
206 Ga0105248_12421127
207 Ga0105249_10453381
208 Ga0157371_11127545
209 Ga0157374_10039567
210 Ga0157375_10109485
211 Ga0157380_10836968
212 Ga0157379_10000927
213 Ga0157379_10307620
214 Ga0157376_10534347
215 Ga0207691_10812067
216 Ga0207703_11891628
217 Ga0207641_10609402
218 Ga0268266_10296471
219 Ga0268264_10000720
220 Ga0265323_10006742
221 Ga0265323_10045000
222 Ga0265338_10353916
223 Ga0265330_10202578
224 Ga0265320_10175464
225 Ga0265331_10026117
226 Ga0265316_10017518
227 Ga0316579_10005033
228 Ga0265314_10004534
229 Ga0265314_10373543
230 Ga0265342_10013077
231 Ga0265342_10536463
232 Ga0316576_10155282
233 Ga0316576_10159688
234 Ga0316576_10899019
235 Ga0316577_10192970
236 Ga0316593_10001783
237 Ga0316593_10003721
238 Ga0316593_10289817
239 Ga0316588_1003430
240 Ga0316587_1000908
241 Ga0316587_1094943
242 Ga0316596_1239229
243 Ga0373954_0156125
244 Ga0373957_0117503
245 Ga0373955_0345873
246 Ga0316574_0179744
247 Ga0316574_0469469
248 Ga0373933_0720050
249 Ga0373937_0644155
250 Ga0316582_0062308
251 Ga0316582_0092586
252 Ga0316582_0156009
253 Ga0316582_0191959
254 Ga0316582_1096967
255 Ga0316584_0050494
256 Ga0316581_0016076
257 Ga0451855_0353687
258 Ga0451577_0018417
259 Ga0451577_0090100
260 Ga0451577_0317597
261 Ga0451577_0677187
262 Ga0451577_0966403
263 Ga0439440_0019774
264 Ga0453683_0447955
265 Ga0453684_0007468
266 Ga0453684_0042819
267 Ga0453684_0111000
268 Ga0453684_0116346
269 Ga0453684_0128219
270 Ga0453684_0235961
271 Ga0453684_0278048
272 Ga0453684_0623233
273 Ga0453684_0753247
274 Ga0451576_0005300
275 Ga0451576_0063362
276 Ga0451576_0470673
277 Ga0451576_1140562
278 Ga0451576_1487654
279 Ga0451576_2188032
280 Ga0495580_0001448
281 Ga0495676_0102522
282 Ga0496104_0036226
283 Ga0496105_0213217
284 Ga0496106_0895933
285 Ga0496110_0516950
286 Ga0496114_0068408
287 Ga0501031_0844072
288 Ga0501040_0230286
289 Ga0501041_0472323
290 Ga0501071_0145214
291 Ga0501072_0692981
292 Ga0501073_0329080
293 Ga0501075_0666371
294 Ga0501076_0015095
295 Ga0501079_0338296
296 Ga0501080_0058519
297 Ga0501081_0263305
298 nmdc:mga05p37_1033115_c1
299 nmdc:mga05p37_78937_c1
300 nmdc:mga09592_247197_c1
301 nmdc:mga09592_51122_c1
302 nmdc:mga0qj67_26657_c1
303 nmdc:mga08y16_525135_c1
304 nmdc:mga0n895_112230_c1
305 nmdc:mga0n895_32532_c1
306 nmdc:mga0n895_56240_c1
307 nmdc:mga0n895_8948_c1
308 nmdc:mga0rr50_1541632_c1
309 nmdc:mga0rr50_231716_c1
310 nmdc:mga0rr50_4708_c1
311 nmdc:mga08x19_14593_c1
312 nmdc:mga0a205_263572_c1
313 nmdc:mga0a205_290552_c1
314 nmdc:mga0a205_390_c1
315 nmdc:mga0a205_585128_c1
316 nmdc:mga0a205_63334_c1
317 Ga0501084_0703664
318 Ga0501084_1372557
319 Ga0501082_0650476
320 Ga0530510_0357705

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17136

ribosomal_L24

Ribosomal proteins 50S L24/mitochondrial 39S L24

50

114

0.98

PF00467

KOW

KOW motif

17

48

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgv-assembly1.cif.gz_t tiamulin bound to the 50s subunit 0.9528 1 101
8cam-assembly1.cif.gz_t evernimicin bound to the 50s subunit 0.9499 1 101
6vwl-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p/e trna (rotated conformation) 0.949 1 101
6vwn-assembly1.cif.gz_S 70s ribosome bound to hiv frameshifting stem-loop (fss) and p-site trna (non-rotated conformation, structure ii) 0.9453 1 101
8a63-assembly1.cif.gz_X cryo-em structure of listeria monocytogenes 50s ribosomal subunit. 0.9425 1 95
ID Description Score Start End Superfamily
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9427 3 36 2.30.30.30
af_C6KSP8_36_136_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.934 1 100 2.30.30.30
af_Q55DJ4_14_116_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9153 3 100 2.30.30.30
af_Q2FW17_1_100_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9076 1 99 2.30.30.30
af_Q653V9_69_173_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8979 1 99 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A2T6DFY4-F1-model_v4 Large ribosomal subunit protein uL24 1.001 2 70 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-B3E0J5-F1-model_v4 Large ribosomal subunit protein uL24 (50S ribosomal protein L24) 0.9986 3 70 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E3EGF2-F1-model_v4 Large ribosomal subunit protein uL24 0.9967 2 74 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2E0R0P5-F1-model_v4 Large ribosomal subunit protein uL24 0.9941 2 70 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A3M1IRI7-F1-model_v4 Large ribosomal subunit protein uL24 0.994 2 70 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map