F233855

General Info

Members Datasets Scaffolds Average Seq Length
160 129 159 193

Family's Representative Sequence

Representative Sequence 3300005345|Ga0070692_10262518|Ga0070692_102625182
Length 209
Sequence MNVLLIDNYDSFTYNLAQYLGELGAEVAVERNDAITLDAIAHRAPHAIVISPGPCTPNEAGISMDVVRRFAGATPILGVCLGHQCIGQVMGGRIVRAPRVMHGKTSKIFHDERGLYAGVENPFVATRYHSLVIAPDSMPDALEVTAKTWEDEIMGVRGRRTAAPLEGVQFHPESIMTAVGKQLLANFLRMAREPRPAGAADAGAKMVAP

Samples

Sample ID Description Type Environment
1 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
60 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
69 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
70 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
71 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
72 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
73 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
78 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
86 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
87 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
96 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
97 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
98 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
99 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
100 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
107 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
122 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
123 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
124 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.38
Metatranscriptomes 0
Isolates 0.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.25
Nodule 0
Rhizoplane 0.62
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 13.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100415076 3300005334 Bacteria 1110
2 Ga0070689_100065214 3300005340 Bacteria 2835
3 Ga0070692_10262518 3300005345 Bacteria 1039
4 Ga0070668_100383609 3300005347 Bacteria 1196
5 Ga0070710_10032270 3300005437 Bacteria 2836
6 Ga0070681_10001812 3300005458 Bacteria 19234
7 Ga0070706_100129813 3300005467 Bacteria 2352
8 Ga0070706_100399485 3300005467 Bacteria 1279
9 Ga0070707_100740743 3300005468 Bacteria 946
10 Ga0070698_100011463 3300005471 Bacteria 9407
11 Ga0070699_100687926 3300005518 Bacteria 934
12 Ga0070679_100059908 3300005530 Bacteria 3793
13 Ga0070697_100000116 3300005536 Bacteria 62538
14 Ga0070695_100130597 3300005545 Bacteria 1731
15 Ga0070695_100210210 3300005545 Bacteria 1396
16 Ga0070665_100344231 3300005548 Bacteria 1496
17 Ga0068864_100167125 3300005618 Unclassified 2003
18 Ga0068861_100408687 3300005719 Bacteria 1206
19 Ga0068862_100601548 3300005844 Bacteria 1056
20 Ga0070717_10078510 3300006028 Bacteria 2766
21 Ga0075365_10010682 3300006038 Bacteria 5362
22 Ga0075363_100012350 3300006048 Bacteria 4115
23 Ga0075364_10080866 3300006051 Bacteria 2148
24 Ga0075362_10131081 3300006177 Bacteria 1192
25 Ga0075367_10004100 3300006178 Bacteria 7060
26 Ga0075366_10000319 3300006195 Bacteria 21915
27 Ga0068871_101024155 3300006358 Bacteria 770
28 Ga0075428_100134845 3300006844 Bacteria 2685
29 Ga0075428_100845245 3300006844 Bacteria 972
30 Ga0075431_100011941 3300006847 Bacteria 8762
31 Ga0075431_100175587 3300006847 Bacteria 2201
32 Ga0075433_10167867 3300006852 Bacteria 1953
33 Ga0075434_100838297 3300006871 Bacteria 935
34 Ga0075434_100943030 3300006871 Bacteria 877
35 Ga0075436_100491524 3300006914 Bacteria 897
36 Ga0075435_100301020 3300007076 Bacteria 1371
37 Ga0075435_100357313 3300007076 Bacteria 1253
38 Ga0111539_10003271 3300009094 Bacteria 21415
39 Ga0114129_10038497 3300009147 Bacteria 6745
40 Ga0114129_10969007 3300009147 Bacteria 1073
41 Ga0105243_11129510 3300009148 Bacteria 793
42 Ga0105249_10020850 3300009553 Bacteria 5861
43 Ga0105249_10268149 3300009553 Bacteria 1700
44 Ga0105249_12165845 3300009553 Bacteria 629
45 Ga0163163_10130934 3300014325 Bacteria 2549
46 Ga0163163_11125834 3300014325 Bacteria 848
47 Ga0213874_10000241 3300021377 Bacteria 10351
48 Ga0207684_10002181 3300025910 Bacteria 20037
49 Ga0207684_10076936 3300025910 Bacteria 2837
50 Ga0207707_10006894 3300025912 Bacteria 9910
51 Ga0207652_10174350 3300025921 Bacteria 1931
52 Ga0207670_10084197 3300025936 Bacteria 2232
53 Ga0207689_10371806 3300025942 Bacteria 1189
54 Ga0207712_10085881 3300025961 Bacteria 2304
55 Ga0207712_11443139 3300025961 Bacteria 616
56 Ga0207668_10374979 3300025972 Bacteria 1196
57 Ga0207708_10454596 3300026075 Bacteria 1067
58 Ga0207676_10446690 3300026095 Bacteria 1218
59 Ga0207675_100284993 3300026118 Bacteria 1606
60 Ga0209813_10040120 3300027866 Bacteria 1421
61 Ga0207428_10003599 3300027907 Bacteria 14966
62 Ga0268264_10863701 3300028381 Bacteria 907
63 Ga0307517_10109183 3300028786 Bacteria 2118
64 Ga0307515_10006679 3300028794 Bacteria 22988
65 Ga0265332_10093665 3300031238 Bacteria 1269
66 Ga0307509_10103551 3300031507 Bacteria 2874
67 Ga0307509_10298664 3300031507 Bacteria 1360
68 Ga0307508_10156880 3300031616 Bacteria 1880
69 Ga0316575_10054425 3300031665 Bacteria 1594
70 Ga0316579_10063373 3300031691 Bacteria 1742
71 Ga0316578_10002290 3300031728 Bacteria 8316
72 Ga0316577_10061599 3300031733 Bacteria 2094
73 Ga0316577_10145981 3300031733 Bacteria 1333
74 Ga0316580_10004372 3300032139 Bacteria 4094
75 Ga0307507_10109480 3300033179 Bacteria 2265
76 Ga0373932_0039671 3300035112 Bacteria 1352
77 Ga0373936_0000018 3300035113 Bacteria 156705
78 Ga0316574_0001663 3300035398 Bacteria 10713
79 Ga0316574_0192012 3300035398 Bacteria 1313
80 Ga0316582_0011567 3300036647 Bacteria 4886
81 Ga0316582_0014620 3300036647 Bacteria 4461
82 Ga0316584_0003004 3300036712 Bacteria 10859
83 Ga0316584_0029263 3300036712 Bacteria 4066
84 Ga0316584_0206382 3300036712 Bacteria 1448
85 Ga0400484_07401 3300038725 Bacteria 4333
86 Ga0400490_13882 3300038726 Bacteria 46633
87 Ga0400490_38409 3300038726 Bacteria 4572
88 Ga0400491_28541 3300038727 Bacteria 1709
89 Ga0400485_18349 3300038735 Bacteria 9811
90 Ga0400486_30166 3300038742 Bacteria 39222
91 Ga0400483_151967 3300039062 Bacteria 7339
92 Ga0400489_90983 3300039093 Bacteria 25837
93 Ga0400487_02657 3300039110 Bacteria 1105
94 Ga0436363_0374880 3300039450 Bacteria 9306
95 Ga0436363_0582489 3300039450 Bacteria 2737
96 Ga0436363_0583504 3300039450 Bacteria 740
97 Ga0436363_1669043 3300039450 Bacteria 7823
98 Ga0439441_002476 3300042001 Bacteria 2607
99 Ga0453683_0089900 3300044673 Bacteria 1925
100 Ga0453684_0511076 3300044712 Bacteria 1329
101 Ga0495592_0004500 3300046454 Bacteria 10202
102 Ga0495628_0006488 3300046516 Bacteria 10215
103 Ga0495652_0015132 3300046529 Bacteria 6910
104 Ga0495645_0006336 3300046543 Bacteria 8208
105 Ga0495622_0040035 3300046557 Bacteria 2182
106 Ga0495599_0000794 3300046678 Bacteria 17733
107 Ga0496108_0000087 3300048911 Bacteria 97626
108 Ga0501031_0019446 3300049568 Bacteria 4426
109 Ga0501034_0096591 3300049571 Bacteria 2951
110 Ga0501040_0019243 3300049576 Bacteria 4542
111 Ga0501041_0080693 3300049577 Bacteria 2003
112 Ga0501042_0007902 3300049578 Bacteria 6996
113 Ga0501046_0065164 3300049580 Bacteria 2843
114 Ga0501046_0278892 3300049580 Bacteria 1225
115 Ga0501047_0057388 3300049581 Bacteria 3765
116 Ga0501048_0052457 3300049582 Bacteria 2902
117 Ga0501069_0046364 3300049585 Bacteria 2411
118 Ga0501070_0062429 3300049586 Bacteria 3086
119 Ga0501070_0404794 3300049586 Bacteria 1103
120 Ga0501071_0100544 3300049587 Bacteria 2131
121 Ga0501072_0031084 3300049588 Bacteria 4178
122 Ga0501072_0899470 3300049588 Bacteria 691
123 Ga0501074_0024443 3300049590 Bacteria 4392
124 Ga0501075_0048769 3300049591 Bacteria 3182
125 Ga0501076_0002009 3300049592 Bacteria 13914
126 Ga0501077_0081045 3300049593 Bacteria 2056
127 Ga0501079_0070064 3300049741 Bacteria 2707
128 Ga0501080_0209020 3300049742 Bacteria 1789
129 Ga0501083_0215387 3300049744 Bacteria 1252
130 nmdc:mga03683_208993_c1 3300050489 Bacteria 898
131 nmdc:mga0yw44_46399_c1 3300050492 Bacteria 2609
132 nmdc:mga0k408_34583_c1 3300050493 Bacteria 2894
133 nmdc:mga06z11_70802_c1 3300050494 Bacteria 1845
134 nmdc:mga04h51_47986_c1 3300050495 Bacteria 1421
135 nmdc:mga07m45_20009_c1 3300050496 Bacteria 3632
136 nmdc:mga05p37_5249_c1 3300050507 Bacteria 15211
137 nmdc:mga05p37_991027_c1 3300050507 Bacteria 894
138 nmdc:mga09592_30835_c1 3300050508 Bacteria 4464
139 nmdc:mga0qj67_75548_c1 3300050509 Bacteria 2693
140 nmdc:mga06r32_158567_c1 3300050510 Bacteria 2245
141 nmdc:mga06r32_416669_c1 3300050510 Bacteria 1324
142 nmdc:mga06r32_468006_c1 3300050510 Bacteria 1239
143 nmdc:mga08y16_23286_c1 3300050511 Bacteria 6541
144 nmdc:mga0n895_1238217_c1 3300050512 Bacteria 719
145 nmdc:mga0n895_134740_c1 3300050512 Bacteria 2496
146 nmdc:mga0rr50_353462_c1 3300050513 Bacteria 1236
147 nmdc:mga08x19_270254_c1 3300050514 Bacteria 1176
148 nmdc:mga0a205_59778_c1 3300050515 Bacteria 3681
149 Ga0495601_0017238 3300053077 Bacteria 4384
150 Ga0500646_0008624 3300053090 Bacteria 2610
151 Ga0500566_0085106 3300053094 Bacteria 1754
152 Ga0500654_047999 3300053099 Bacteria 2336
153 Ga0500642_0069988 3300053130 Bacteria 1594
154 Ga0500568_0007670 3300053139 Bacteria 5271
155 Ga0501084_0005362 3300054114 Bacteria 10508
156 Ga0501084_0472862 3300054114 Bacteria 1059
157 Ga0501082_0009679 3300060353 Bacteria 8299
158 Ga0501082_0712223 3300060353 Bacteria 879
159 Ga0530510_0022024 3300061734 Bacteria 4537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0014620 Ga0316582_0014620_1656_2213 184
2 3300009553 Ga0105249_12165845 Ga0105249_121658451 186
3 3300025961 Ga0207712_11443139 Ga0207712_114431391 186
4 3300005467 Ga0070706_100129813 Ga0070706_1001298131 187
5 3300005467 Ga0070706_100399485 Ga0070706_1003994852 187
6 3300005468 Ga0070707_100740743 Ga0070707_1007407432 187
7 3300005536 Ga0070697_100000116 Ga0070697_1000001168 187
8 3300005618 Ga0068864_100167125 Ga0068864_1001671252 187
9 3300006871 Ga0075434_100838297 Ga0075434_1008382972 187
10 3300009147 Ga0114129_10038497 Ga0114129_100384973 187
11 3300009147 Ga0114129_10969007 Ga0114129_109690072 187
12 3300014325 Ga0163163_10130934 Ga0163163_101309342 187
13 3300025910 Ga0207684_10002181 Ga0207684_100021813 187
14 3300025910 Ga0207684_10076936 Ga0207684_100769363 187
15 3300031728 Ga0316578_10002290 Ga0316578_100022902 187
16 3300032139 Ga0316580_10004372 Ga0316580_100043722 187
17 3300035398 Ga0316574_0001663 Ga0316574_0001663_5943_6509 187
18 3300036647 Ga0316582_0011567 Ga0316582_0011567_1144_1710 187
19 3300036712 Ga0316584_0003004 Ga0316584_0003004_9703_10269 187
20 3300049568 Ga0501031_0019446 Ga0501031_0019446_1831_2394 187
21 3300049576 Ga0501040_0019243 Ga0501040_0019243_2606_3169 187
22 3300049577 Ga0501041_0080693 Ga0501041_0080693_467_1030 187
23 3300049578 Ga0501042_0007902 Ga0501042_0007902_2179_2742 187
24 3300049580 Ga0501046_0065164 Ga0501046_0065164_619_1182 187
25 3300049582 Ga0501048_0052457 Ga0501048_0052457_865_1428 187
26 3300049586 Ga0501070_0404794 Ga0501070_0404794_73_636 187
27 3300049587 Ga0501071_0100544 Ga0501071_0100544_1051_1614 187
28 3300049588 Ga0501072_0031084 Ga0501072_0031084_1906_2469 187
29 3300049590 Ga0501074_0024443 Ga0501074_0024443_2693_3256 187
30 3300049591 Ga0501075_0048769 Ga0501075_0048769_434_997 187
31 3300049592 Ga0501076_0002009 Ga0501076_0002009_4591_5154 187
32 3300049593 Ga0501077_0081045 Ga0501077_0081045_1386_1949 187
33 3300049741 Ga0501079_0070064 Ga0501079_0070064_1297_1860 187
34 3300050507 nmdc:mga05p37_5249_c1 nmdc:mga05p37_5249_c1_10350_10916 187
35 3300050507 nmdc:mga05p37_991027_c1 nmdc:mga05p37_991027_c1_219_785 187
36 3300050512 nmdc:mga0n895_1238217_c1 nmdc:mga0n895_1238217_c1_82_648 187
37 3300054114 Ga0501084_0005362 Ga0501084_0005362_5340_5903 187
38 3300060353 Ga0501082_0009679 Ga0501082_0009679_3978_4541 187
39 3300061734 Ga0530510_0022024 Ga0530510_0022024_1782_2345 187
40 3300006844 Ga0075428_100845245 Ga0075428_1008452452 188
41 3300009148 Ga0105243_11129510 Ga0105243_111295101 188
42 3300038726 Ga0400490_38409 Ga0400490_38409_544_1110 188
43 3300039062 Ga0400483_151967 Ga0400483_151967_1572_2138 188
44 3300050512 nmdc:mga0n895_134740_c1 nmdc:mga0n895_134740_c1_915_1484 188
45 3300054114 Ga0501084_0472862 Ga0501084_0472862_483_1049 188
46 3300005347 Ga0070668_100383609 Ga0070668_1003836092 189
47 3300005719 Ga0068861_100408687 Ga0068861_1004086872 189
48 3300006038 Ga0075365_10010682 Ga0075365_100106824 189
49 3300006048 Ga0075363_100012350 Ga0075363_1000123503 189
50 3300006051 Ga0075364_10080866 Ga0075364_100808662 189
51 3300006177 Ga0075362_10131081 Ga0075362_101310812 189
52 3300006178 Ga0075367_10004100 Ga0075367_100041008 189
53 3300006195 Ga0075366_10000319 Ga0075366_100003194 189
54 3300006358 Ga0068871_101024155 Ga0068871_1010241552 189
55 3300006844 Ga0075428_100134845 Ga0075428_1001348452 189
56 3300006847 Ga0075431_100011941 Ga0075431_1000119417 189
57 3300006852 Ga0075433_10167867 Ga0075433_101678673 189
58 3300006871 Ga0075434_100943030 Ga0075434_1009430302 189
59 3300007076 Ga0075435_100301020 Ga0075435_1003010202 189
60 3300009094 Ga0111539_10003271 Ga0111539_100032713 189
61 3300009553 Ga0105249_10268149 Ga0105249_102681492 189
62 3300025972 Ga0207668_10374979 Ga0207668_103749792 189
63 3300026075 Ga0207708_10454596 Ga0207708_104545962 189
64 3300026118 Ga0207675_100284993 Ga0207675_1002849932 189
65 3300027866 Ga0209813_10040120 Ga0209813_100401202 189
66 3300027907 Ga0207428_10003599 Ga0207428_100035999 189
67 3300031665 Ga0316575_10054425 Ga0316575_100544252 189
68 3300031691 Ga0316579_10063373 Ga0316579_100633732 189
69 3300031733 Ga0316577_10061599 Ga0316577_100615992 189
70 3300031733 Ga0316577_10145981 Ga0316577_101459812 189
71 3300035112 Ga0373932_0039671 Ga0373932_0039671_358_930 189
72 3300036712 Ga0316584_0029263 Ga0316584_0029263_1346_1915 189
73 3300036712 Ga0316584_0206382 Ga0316584_0206382_667_1236 189
74 3300039450 Ga0436363_1669043 Ga0436363_1669043_2636_3250 189
75 3300046454 Ga0495592_0004500 Ga0495592_0004500_1889_2458 189
76 3300046516 Ga0495628_0006488 Ga0495628_0006488_4568_5137 189
77 3300046529 Ga0495652_0015132 Ga0495652_0015132_4363_4932 189
78 3300046543 Ga0495645_0006336 Ga0495645_0006336_5550_6119 189
79 3300046678 Ga0495599_0000794 Ga0495599_0000794_12086_12655 189
80 3300050489 nmdc:mga03683_208993_c1 nmdc:mga03683_208993_c1_289_858 189
81 3300050492 nmdc:mga0yw44_46399_c1 nmdc:mga0yw44_46399_c1_598_1167 189
82 3300050493 nmdc:mga0k408_34583_c1 nmdc:mga0k408_34583_c1_486_1055 189
83 3300050494 nmdc:mga06z11_70802_c1 nmdc:mga06z11_70802_c1_242_811 189
84 3300050495 nmdc:mga04h51_47986_c1 nmdc:mga04h51_47986_c1_483_1052 189
85 3300050496 nmdc:mga07m45_20009_c1 nmdc:mga07m45_20009_c1_428_997 189
86 3300050508 nmdc:mga09592_30835_c1 nmdc:mga09592_30835_c1_1107_1676 189
87 3300050509 nmdc:mga0qj67_75548_c1 nmdc:mga0qj67_75548_c1_553_1122 189
88 3300050510 nmdc:mga06r32_158567_c1 nmdc:mga06r32_158567_c1_147_743 189
89 3300050510 nmdc:mga06r32_416669_c1 nmdc:mga06r32_416669_c1_506_1102 189
90 3300050510 nmdc:mga06r32_468006_c1 nmdc:mga06r32_468006_c1_59_634 189
91 3300050511 nmdc:mga08y16_23286_c1 nmdc:mga08y16_23286_c1_2886_3455 189
92 3300050515 nmdc:mga0a205_59778_c1 nmdc:mga0a205_59778_c1_913_1509 189
93 3300053077 Ga0495601_0017238 Ga0495601_0017238_753_1322 189
94 3300005471 Ga0070698_100011463 Ga0070698_1000114633 190
95 3300021377 Ga0213874_10000241 Ga0213874_1000024111 190
96 3300035398 Ga0316574_0192012 Ga0316574_0192012_499_1101 190
97 3300039450 Ga0436363_0374880 Ga0436363_0374880_3468_4040 190
98 3300039450 Ga0436363_0582489 Ga0436363_0582489_2102_2674 190
99 3300042001 Ga0439441_002476 Ga0439441_002476_361_933 190
100 3300049581 Ga0501047_0057388 Ga0501047_0057388_108_683 190
101 3300049744 Ga0501083_0215387 Ga0501083_0215387_635_1207 190
102 3300038725 Ga0400484_07401 Ga0400484_07401_3033_3608 191
103 3300038726 Ga0400490_13882 Ga0400490_13882_10478_11053 191
104 3300038727 Ga0400491_28541 Ga0400491_28541_19_594 191
105 3300038735 Ga0400485_18349 Ga0400485_18349_4217_4792 191
106 3300038742 Ga0400486_30166 Ga0400486_30166_33627_34202 191
107 3300039093 Ga0400489_90983 Ga0400489_90983_11279_11854 191
108 3300039450 Ga0436363_0583504 Ga0436363_0583504_39_617 191
109 3300006847 Ga0075431_100175587 Ga0075431_1001755873 194
110 3300006028 Ga0070717_10078510 Ga0070717_100785102 195
111 3300006914 Ga0075436_100491524 Ga0075436_1004915242 195
112 3300007076 Ga0075435_100357313 Ga0075435_1003573132 195
113 3300050513 nmdc:mga0rr50_353462_c1 nmdc:mga0rr50_353462_c1_393_983 195
114 3300050514 nmdc:mga08x19_270254_c1 nmdc:mga08x19_270254_c1_159_749 195
115 3300031507 Ga0307509_10298664 Ga0307509_102986642 196
116 3300005458 Ga0070681_10001812 Ga0070681_1000181213 197
117 3300005518 Ga0070699_100687926 Ga0070699_1006879261 197
118 3300005530 Ga0070679_100059908 Ga0070679_1000599083 197
119 3300005545 Ga0070695_100210210 Ga0070695_1002102102 197
120 3300025912 Ga0207707_10006894 Ga0207707_100068945 197
121 3300025921 Ga0207652_10174350 Ga0207652_101743502 197
122 3300025942 Ga0207689_10371806 Ga0207689_103718062 197
123 3300039110 Ga0400487_02657 Ga0400487_02657_211_804 197
124 3300049571 Ga0501034_0096591 Ga0501034_0096591_2114_2707 197
125 3300049742 Ga0501080_0209020 Ga0501080_0209020_1059_1652 197
126 3300005340 Ga0070689_100065214 Ga0070689_1000652141 198
127 3300005548 Ga0070665_100344231 Ga0070665_1003442312 198
128 3300005844 Ga0068862_100601548 Ga0068862_1006015482 198
129 3300009553 Ga0105249_10020850 Ga0105249_100208507 198
130 3300025936 Ga0207670_10084197 Ga0207670_100841972 198
131 3300025961 Ga0207712_10085881 Ga0207712_100858813 198
132 3300026095 Ga0207676_10446690 Ga0207676_104466902 198
133 3300028381 Ga0268264_10863701 Ga0268264_108637012 198
134 3300028786 Ga0307517_10109183 Ga0307517_101091832 198
135 3300035113 Ga0373936_0000018 Ga0373936_0000018_104157_104756 198
136 3300053090 Ga0500646_0008624 Ga0500646_0008624_404_1012 198
137 3300053094 Ga0500566_0085106 Ga0500566_0085106_411_1010 198
138 3300053099 Ga0500654_047999 Ga0500654_047999_872_1480 198
139 3300053130 Ga0500642_0069988 Ga0500642_0069988_933_1532 198
140 3300031616 Ga0307508_10156880 Ga0307508_101568802 199
141 3300033179 Ga0307507_10109480 Ga0307507_101094802 199
142 3300044673 Ga0453683_0089900 Ga0453683_0089900_537_1139 199
143 3300005545 Ga0070695_100130597 Ga0070695_1001305972 200
144 3300028794 Ga0307515_10006679 Ga0307515_1000667918 200
145 3300049580 Ga0501046_0278892 Ga0501046_0278892_519_1121 200
146 3300049585 Ga0501069_0046364 Ga0501069_0046364_1119_1724 200
147 3300049586 Ga0501070_0062429 Ga0501070_0062429_1339_1944 200
148 3300049588 Ga0501072_0899470 Ga0501072_0899470_40_645 200
149 3300053139 Ga0500568_0007670 Ga0500568_0007670_1150_1764 200
150 3300031507 Ga0307509_10103551 Ga0307509_101035512 202
151 3300046557 Ga0495622_0040035 Ga0495622_0040035_588_1199 202
152 3300060353 Ga0501082_0712223 Ga0501082_0712223_109_717 202
153 iso_pu_bacteria 2684623219 2687238804 202
154 3300014325 Ga0163163_11125834 Ga0163163_111258342 203
155 3300031238 Ga0265332_10093665 Ga0265332_100936652 203
156 3300048911 Ga0496108_0000087 Ga0496108_0000087_88058_88669 203
157 3300044712 Ga0453684_0511076 Ga0453684_0511076_407_1036 205
158 3300005437 Ga0070710_10032270 Ga0070710_100322702 206
159 3300005334 Ga0068869_100415076 Ga0068869_1004150762 208
160 3300005345 Ga0070692_10262518 Ga0070692_102625182 208

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

4

191

0.95

PF07722

Peptidase_C26

Peptidase C26

62

173

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9309 2 187
8hx7-assembly1.cif.gz_B crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with l-glutamine 0.9229 2 190
8hx6-assembly1.cif.gz_A crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae 0.92 2 190
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.9193 1 193
6qur-assembly1.cif.gz_A mapping the allosteric communication network of aminodeoxychorismate synthase 0.9157 1 188
ID Description Score Start End Superfamily
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9699 1 188 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9597 1 188 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9566 1 188 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9517 2 188 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9419 1 188 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7V1MHK6-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9952 1 116 GO:0000162
GO:0004049
GO:0005829
AF-A0A523TF43-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9938 1 155 GO:0000162
GO:0004049
GO:0005829
AF-A0A5D6Y537-F1-model_v4 anthranilate synthase (EC 4.1.3.27) 0.9938 2 159 GO:0000162
GO:0004049
GO:0005829
AF-A0A0P9MTB2-F1-model_v4 Anthranilate synthase component II 0.9933 3 113 GO:0000162
GO:0004049
GO:0005829
GO:0046654
GO:0046820
AF-A0A351SBL0-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9927 1 99 GO:0000162
GO:0004049
GO:0005829

Feature Viewer

pLDDT pTM Quality
90.61 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map