F233203

General Info

Members Datasets Scaffolds Average Seq Length
159 121 318 120

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0581183|Ga0501075_0581183_235_669
Length 144
Sequence LIRIKAALIPRWLDAFAKDRFDPQRRQKMGIHATPEIPGTPIFDGDAAQKGYALNRMCFSFNSAENRAEFLRDEDAYCAKFRLTPAQRAAVKHRNVLEMIEAGGNVYYLAKLAGIFGLNVQDIGAQQTGMTVEAFKAKLAAAGR

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
28 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
38 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
72 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
79 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
80 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
81 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
84 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
85 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
86 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
92 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
93 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.29
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 5.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0581183 3300049591 Bacteria 855
2 Ga0065707_10760675 3300005295 Bacteria 614
3 Ga0070683_101114636 3300005329 Bacteria 758
4 Ga0070670_100056140 3300005331 Bacteria 3379
5 Ga0068869_100063091 3300005334 Bacteria 2721
6 Ga0068869_100165831 3300005334 Bacteria 1723
7 Ga0070666_10127137 3300005335 Bacteria 1769
8 Ga0070666_10268912 3300005335 Bacteria 1209
9 Ga0070668_100127452 3300005347 Bacteria 2040
10 Ga0070668_102159410 3300005347 Bacteria 514
11 Ga0070674_101698914 3300005356 Unclassified 571
12 Ga0070667_100047129 3300005367 Bacteria 3626
13 Ga0070667_100522274 3300005367 Bacteria 1090
14 Ga0070713_100173834 3300005436 Bacteria 1931
15 Ga0070701_10098322 3300005438 Bacteria 1616
16 Ga0070700_100430494 3300005441 Bacteria 999
17 Ga0070685_10346066 3300005466 Bacteria 1015
18 Ga0068853_100027721 3300005539 Bacteria 4761
19 Ga0070686_100451727 3300005544 Bacteria 988
20 Ga0070665_100017974 3300005548 Bacteria 7099
21 Ga0070665_100153793 3300005548 Bacteria 2302
22 Ga0068859_100216281 3300005617 Bacteria 2004
23 Ga0068859_100654163 3300005617 Bacteria 1143
24 Ga0068861_100028319 3300005719 Bacteria 4087
25 Ga0068861_100363706 3300005719 Bacteria 1273
26 Ga0068870_10093010 3300005840 Unclassified 1690
27 Ga0068858_101115698 3300005842 Bacteria 774
28 Ga0068860_100166675 3300005843 Bacteria 2127
29 Ga0068860_101646351 3300005843 Unclassified 664
30 Ga0068860_101811561 3300005843 Bacteria 632
31 Ga0068862_101181517 3300005844 Bacteria 763
32 Ga0068862_102146935 3300005844 Bacteria 570
33 Ga0081455_10001789 3300005937 Bacteria 25970
34 Ga0097620_100216261 3300006931 Bacteria 2004
35 Ga0097620_100654118 3300006931 Bacteria 1143
36 Ga0105240_10005589 3300009093 Bacteria 18679
37 Ga0111539_10193487 3300009094 Bacteria 2373
38 Ga0105245_10367030 3300009098 Bacteria 1430
39 Ga0105247_10517635 3300009101 Bacteria 872
40 Ga0105247_10655859 3300009101 Bacteria 785
41 Ga0105242_10649966 3300009176 Bacteria 1025
42 Ga0105242_13120697 3300009176 Bacteria 514
43 Ga0105248_10148782 3300009177 Bacteria 2642
44 Ga0105248_10246739 3300009177 Bacteria 2010
45 Ga0105237_10088225 3300009545 Bacteria 3091
46 Ga0157371_10116871 3300013102 Bacteria 1896
47 Ga0157374_10746084 3300013296 Bacteria 993
48 Ga0163162_10922220 3300013306 Bacteria 986
49 Ga0157372_10068915 3300013307 Bacteria 3978
50 Ga0163163_10074630 3300014325 Bacteria 3384
51 Ga0163163_11198306 3300014325 Bacteria 822
52 Ga0157380_10771763 3300014326 Bacteria 975
53 Ga0157379_10049639 3300014968 Bacteria 3747
54 Ga0157379_10254792 3300014968 Bacteria 1594
55 Ga0157376_11083876 3300014969 Bacteria 826
56 Ga0207680_10198437 3300025903 Bacteria 1366
57 Ga0207680_10358364 3300025903 Bacteria 1025
58 Ga0207643_10413505 3300025908 Bacteria 854
59 Ga0207695_10044831 3300025913 Bacteria 4700
60 Ga0207671_10084104 3300025914 Bacteria 2389
61 Ga0207650_10487287 3300025925 Bacteria 1029
62 Ga0207650_11691867 3300025925 Bacteria 536
63 Ga0207700_10499183 3300025928 Bacteria 1077
64 Ga0207711_10081034 3300025941 Bacteria 2836
65 Ga0207711_10211794 3300025941 Bacteria 1770
66 Ga0207689_10192569 3300025942 Bacteria 1682
67 Ga0207689_10745551 3300025942 Bacteria 826
68 Ga0207661_10857484 3300025944 Bacteria 836
69 Ga0207668_10931748 3300025972 Bacteria 774
70 Ga0207668_12088231 3300025972 Bacteria 510
71 Ga0207658_10208236 3300025986 Bacteria 1637
72 Ga0207703_10020741 3300026035 Bacteria 5141
73 Ga0207703_11354514 3300026035 Bacteria 684
74 Ga0207708_10183212 3300026075 Bacteria 1663
75 Ga0207676_11229473 3300026095 Unclassified 743
76 Ga0207675_100137790 3300026118 Bacteria 2317
77 Ga0207675_100450118 3300026118 Bacteria 1276
78 Ga0268265_10662024 3300028380 Bacteria 1005
79 Ga0268265_11071217 3300028380 Bacteria 799
80 Ga0265338_10014192 3300028800 Bacteria 8897
81 Ga0265338_10027490 3300028800 Bacteria 5705
82 Ga0265330_10185188 3300031235 Bacteria 881
83 Ga0265332_10017491 3300031238 Bacteria 3164
84 Ga0265328_10053185 3300031239 Bacteria 1486
85 Ga0265329_10058409 3300031242 Bacteria 1222
86 Ga0265329_10303866 3300031242 Bacteria 540
87 Ga0265340_10024286 3300031247 Bacteria 3080
88 Ga0265331_10032483 3300031250 Bacteria 2586
89 Ga0265316_10072869 3300031344 Bacteria 2646
90 Ga0265316_10290403 3300031344 Bacteria 1193
91 Ga0307513_10030744 3300031456 Bacteria 6096
92 Ga0307509_10000022 3300031507 Bacteria 247822
93 Ga0307514_10000528 3300031649 Bacteria 74778
94 Ga0265314_10146389 3300031711 Bacteria 1454
95 Ga0265342_10265888 3300031712 Bacteria 911
96 Ga0316593_10017653 3300032168 Bacteria 2179
97 Ga0307510_10171255 3300033180 Bacteria 1750
98 Ga0373948_0077324 3300034817 Bacteria 755
99 Ga0373954_0265753 3300035118 Bacteria 845
100 Ga0373943_0911548 3300035170 Bacteria 525
101 Ga0373924_0214948 3300035410 Bacteria 849
102 Ga0373931_0009657 3300035691 Bacteria 4621
103 Ga0373927_1027997 3300035695 Unclassified 544
104 Ga0373937_0523350 3300036401 Bacteria 1127
105 Ga0373937_1222311 3300036401 Bacteria 700
106 Ga0400489_26464 3300039093 Bacteria 2976
107 Ga0439453_0030185 3300041408 Bacteria 1023
108 Ga0439461_0024440 3300041410 Bacteria 1222
109 Ga0451797_1347408 3300041453 Bacteria 519
110 Ga0439445_0028683 3300042004 Bacteria 1436
111 Ga0450898_114313 3300042134 Bacteria 573
112 Ga0439446_0074191 3300042156 Bacteria 1045
113 Ga0439435_0012056 3300042436 Bacteria 2085
114 Ga0450893_0015449 3300042532 Bacteria 1287
115 Ga0451577_0006651 3300042876 Bacteria 11477
116 Ga0451577_0126076 3300042876 Bacteria 2294
117 Ga0451577_0153113 3300042876 Bacteria 2075
118 Ga0453684_0033261 3300044712 Bacteria 7191
119 Ga0451576_0110680 3300045051 Bacteria 2858
120 Ga0451576_1158206 3300045051 Bacteria 808
121 Ga0451576_1784113 3300045051 Bacteria 636
122 Ga0495603_0156680 3300046455 Bacteria 1322
123 Ga0495580_0913229 3300046472 Unclassified 564
124 Ga0495586_0226345 3300046535 Bacteria 1063
125 Ga0495659_0251077 3300046664 Bacteria 737
126 Ga0495658_0686133 3300046683 Bacteria 656
127 Ga0495636_0180228 3300047318 Bacteria 958
128 Ga0495680_0699941 3300047322 Bacteria 669
129 Ga0495677_0441943 3300047445 Unclassified 515
130 Ga0496101_0340132 3300048904 Bacteria 1179
131 Ga0496102_1014065 3300048905 Bacteria 750
132 Ga0496104_0000410 3300048907 Bacteria 37646
133 Ga0496105_0004253 3300048908 Bacteria 10769
134 Ga0496105_0312954 3300048908 Bacteria 1260
135 Ga0496106_0291998 3300048909 Bacteria 1307
136 Ga0496109_0237202 3300048912 Bacteria 1716
137 Ga0496114_0410571 3300048917 Bacteria 1199
138 Ga0496115_0994200 3300048918 Unclassified 641
139 Ga0501034_0561567 3300049571 Bacteria 1050
140 Ga0501038_0384088 3300049574 Bacteria 1089
141 Ga0501038_1340312 3300049574 Unclassified 516
142 Ga0501039_0420975 3300049575 Bacteria 1049
143 Ga0501040_0118059 3300049576 Bacteria 1860
144 Ga0501040_0156612 3300049576 Bacteria 1609
145 Ga0501041_0091702 3300049577 Bacteria 1876
146 Ga0501042_0082261 3300049578 Bacteria 2308
147 Ga0501070_1104061 3300049586 Bacteria 612
148 Ga0501071_0105519 3300049587 Bacteria 2080
149 Ga0501072_0447192 3300049588 Bacteria 1023
150 Ga0501072_1312210 3300049588 Bacteria 561
151 Ga0501074_0126579 3300049590 Bacteria 1828
152 Ga0501076_0279851 3300049592 Bacteria 1367
153 Ga0501076_0770813 3300049592 Bacteria 794
154 Ga0501079_0839508 3300049741 Bacteria 723
155 Ga0501083_0174430 3300049744 Bacteria 1405
156 Ga0501045_0419187 3300049824 Bacteria 996
157 nmdc:mga08y16_189537_c1 3300050511 Bacteria 2133
158 Ga0501084_0145221 3300054114 Bacteria 1998
159 Ga0501084_1306967 3300054114 Bacteria 608
160 Ga0501075_0581183
161 Ga0065707_10760675
162 Ga0070683_101114636
163 Ga0070670_100056140
164 Ga0068869_100063091
165 Ga0068869_100165831
166 Ga0070666_10127137
167 Ga0070666_10268912
168 Ga0070668_100127452
169 Ga0070668_102159410
170 Ga0070674_101698914
171 Ga0070667_100047129
172 Ga0070667_100522274
173 Ga0070713_100173834
174 Ga0070701_10098322
175 Ga0070700_100430494
176 Ga0070685_10346066
177 Ga0068853_100027721
178 Ga0070686_100451727
179 Ga0070665_100017974
180 Ga0070665_100153793
181 Ga0068859_100216281
182 Ga0068859_100654163
183 Ga0068861_100028319
184 Ga0068861_100363706
185 Ga0068870_10093010
186 Ga0068858_101115698
187 Ga0068860_100166675
188 Ga0068860_101646351
189 Ga0068860_101811561
190 Ga0068862_101181517
191 Ga0068862_102146935
192 Ga0081455_10001789
193 Ga0097620_100216261
194 Ga0097620_100654118
195 Ga0105240_10005589
196 Ga0111539_10193487
197 Ga0105245_10367030
198 Ga0105247_10517635
199 Ga0105247_10655859
200 Ga0105242_10649966
201 Ga0105242_13120697
202 Ga0105248_10148782
203 Ga0105248_10246739
204 Ga0105237_10088225
205 Ga0157371_10116871
206 Ga0157374_10746084
207 Ga0163162_10922220
208 Ga0157372_10068915
209 Ga0163163_10074630
210 Ga0163163_11198306
211 Ga0157380_10771763
212 Ga0157379_10049639
213 Ga0157379_10254792
214 Ga0157376_11083876
215 Ga0207680_10198437
216 Ga0207680_10358364
217 Ga0207643_10413505
218 Ga0207695_10044831
219 Ga0207671_10084104
220 Ga0207650_10487287
221 Ga0207650_11691867
222 Ga0207700_10499183
223 Ga0207711_10081034
224 Ga0207711_10211794
225 Ga0207689_10192569
226 Ga0207689_10745551
227 Ga0207661_10857484
228 Ga0207668_10931748
229 Ga0207668_12088231
230 Ga0207658_10208236
231 Ga0207703_10020741
232 Ga0207703_11354514
233 Ga0207708_10183212
234 Ga0207676_11229473
235 Ga0207675_100137790
236 Ga0207675_100450118
237 Ga0268265_10662024
238 Ga0268265_11071217
239 Ga0265338_10014192
240 Ga0265338_10027490
241 Ga0265330_10185188
242 Ga0265332_10017491
243 Ga0265328_10053185
244 Ga0265329_10058409
245 Ga0265329_10303866
246 Ga0265340_10024286
247 Ga0265331_10032483
248 Ga0265316_10072869
249 Ga0265316_10290403
250 Ga0307513_10030744
251 Ga0307509_10000022
252 Ga0307514_10000528
253 Ga0265314_10146389
254 Ga0265342_10265888
255 Ga0316593_10017653
256 Ga0307510_10171255
257 Ga0373948_0077324
258 Ga0373954_0265753
259 Ga0373943_0911548
260 Ga0373924_0214948
261 Ga0373931_0009657
262 Ga0373927_1027997
263 Ga0373937_0523350
264 Ga0373937_1222311
265 Ga0400489_26464
266 Ga0439453_0030185
267 Ga0439461_0024440
268 Ga0451797_1347408
269 Ga0439445_0028683
270 Ga0450898_114313
271 Ga0439446_0074191
272 Ga0439435_0012056
273 Ga0450893_0015449
274 Ga0451577_0006651
275 Ga0451577_0126076
276 Ga0451577_0153113
277 Ga0453684_0033261
278 Ga0451576_0110680
279 Ga0451576_1158206
280 Ga0451576_1784113
281 Ga0495603_0156680
282 Ga0495580_0913229
283 Ga0495586_0226345
284 Ga0495659_0251077
285 Ga0495658_0686133
286 Ga0495636_0180228
287 Ga0495680_0699941
288 Ga0495677_0441943
289 Ga0496101_0340132
290 Ga0496102_1014065
291 Ga0496104_0000410
292 Ga0496105_0004253
293 Ga0496105_0312954
294 Ga0496106_0291998
295 Ga0496109_0237202
296 Ga0496114_0410571
297 Ga0496115_0994200
298 Ga0501034_0561567
299 Ga0501038_0384088
300 Ga0501038_1340312
301 Ga0501039_0420975
302 Ga0501040_0118059
303 Ga0501040_0156612
304 Ga0501041_0091702
305 Ga0501042_0082261
306 Ga0501070_1104061
307 Ga0501071_0105519
308 Ga0501072_0447192
309 Ga0501072_1312210
310 Ga0501074_0126579
311 Ga0501076_0279851
312 Ga0501076_0770813
313 Ga0501079_0839508
314 Ga0501083_0174430
315 Ga0501045_0419187
316 nmdc:mga08y16_189537_c1
317 Ga0501084_0145221
318 Ga0501084_1306967

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07746

LigA

Aromatic-ring-opening dioxygenase LigAB, LigA subunit

54

140

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t1s-assembly1.cif.gz_D structure of the alpha-n-methyltransferase (sonm) and ripp precursor (sona with qsy deletion) heteromeric complex (bound to sah) 0.9098 36 74
7ltr-assembly1.cif.gz_B structure of the heteromeric complex between the alpha-n-methyltransferase (sonm) and a truncated construct of the ripp precursor (sona) (with sam) 0.8856 27 74
8t1s-assembly1.cif.gz_B structure of the alpha-n-methyltransferase (sonm) and ripp precursor (sona with qsy deletion) heteromeric complex (bound to sah) 0.8787 27 74
8t1t-assembly1.cif.gz_D structure of the alpha-n-methyltransferase (sonm) and ripp precursor (sona with qsy deletion) heteromeric complex (bound to sam) 0.868 26 78
1bou-assembly1.cif.gz_C three-dimensional structure of ligab 0.8469 8 117
ID Description Score Start End Superfamily
3wpmB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.8589 12 109 1.10.700.10
3wraB02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.8582 12 110 1.10.700.10
3wkuA02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.8516 12 111 1.10.700.10
1bouC00 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.8469 8 117 1.10.700.10
3wr8A02 Mainly Alpha;Orthogonal Bundle;Protocatechuate 4,5-dioxygenase; Chain A;Dioxygenase LigAB, LigA subunit 0.846 12 111 1.10.700.10
ID Description Score Start End GO Terms
AF-A0A4Q5RYM8-F1-model_v4 Extradiol ring-cleavage dioxygenase LigAB LigA subunit domain-containing protein 0.9503 15 88
AF-A0A1G0JNB5-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9411 24 117 GO:0051213
AF-A0A1F4PDM0-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9241 1 92 GO:0051213
AF-A0A1G0JNB5-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9225 24 117 GO:0051213
AF-A0A4R2NG98-F1-model_v4 Protocatechuate 4,5-dioxygenase alpha subunit 0.9215 10 115 GO:0051213

Map