F233174

General Info

Members Datasets Scaffolds Average Seq Length
159 120 141 259

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0007960|Ga0501046_0007960_7782_8741
Length 299
Sequence MRPIVCLFAFTAPSALAQGGVTMQLDFTGTVVIVTGAARGIGRAIAERFLTEGAKVAALDVGFPDDERAAFSARLLQVACDVTDAASVDAAIDRVLEFFGRVDVLINNAGITVDAPFEEVGPERFRRVMDVNVTGPFLLARAVAPIMKRQQRGRIINAASFAAIVPAFGGVAYATSKAAVVQLTKVLAGELGPWNITVNAYAPGMIPTAMNGFADMPAAQQSRLLDTLTLRRWGETGDIADLLCFLASDAAGYITGALIDVSGGKLATQIPSKAYEVAGLVGAKPADATPVADGSSPAN

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221629 Devosia sp. Root105 Isolate Unclassified
3 2643221662 Devosia sp. Root413D1 Isolate Unclassified
4 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
5 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
6 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
7 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
8 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
9 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
10 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
11 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
12 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
13 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
14 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
15 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
16 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
17 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
18 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
19 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
60 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
61 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
62 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
72 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
75 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
76 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
80 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
81 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
82 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
83 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
84 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
85 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
107 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
108 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
109 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
115 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.68
Metatranscriptomes 0
Isolates 11.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.63
Bulb 0
Endosphere 11.95
Nodule 0
Rhizoplane 2.52
Rhizosphere 69.81
Stem 0
Stem Tuber 0
Unclassified 15.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004966 3300000549 Bacteria 1704
2 rootH2_10038960 3300003320 Bacteria 4132
3 rootH1_10204138 3300003323 Bacteria 2997
4 Ga0055527_1000003 3300003760 Bacteria 705001
5 Ga0055542_1000005 3300003762 Bacteria 550280
6 Ga0055529_1000006 3300003763 Bacteria 416978
7 Ga0070658_10171557 3300005327 Bacteria 1822
8 Ga0070682_100141594 3300005337 Bacteria 1640
9 Ga0070661_100256755 3300005344 Bacteria 1350
10 Ga0068853_100058940 3300005539 Bacteria 3316
11 Ga0068855_100122431 3300005563 Bacteria 2976
12 Ga0068855_100206758 3300005563 Bacteria 2208
13 Ga0068858_100280919 3300005842 Bacteria 1585
14 Ga0081455_10055652 3300005937 Bacteria 3364
15 Ga0075364_10047917 3300006051 Bacteria 2785
16 Ga0075362_10089536 3300006177 Bacteria 1427
17 Ga0075367_10011543 3300006178 Bacteria 4680
18 Ga0075366_10182621 3300006195 Bacteria 1274
19 Ga0075370_10010455 3300006353 Bacteria 4853
20 Ga0105244_10159893 3300009036 Bacteria 1076
21 Ga0157372_10936400 3300013307 Bacteria 1004
22 Ga0163161_10566539 3300017792 Bacteria 933
23 Ga0209672_100003 3300025228 Bacteria 1560476
24 Ga0209147_100511 3300025229 Bacteria 22600
25 Ga0209258_103707 3300025242 Bacteria 3174
26 Ga0209148_1000004 3300025254 Bacteria 1844481
27 Ga0209455_1000091 3300025272 Bacteria 223115
28 Ga0207655_1091140 3300025728 Bacteria 1072
29 Ga0207694_10470597 3300025924 Bacteria 1050
30 Ga0207667_10174639 3300025949 Bacteria 2208
31 Ga0207667_10304445 3300025949 Bacteria 1628
32 Ga0207698_10322245 3300026142 Bacteria 1448
33 Ga0307408_100239710 3300031548 Bacteria 1490
34 Ga0307405_10270988 3300031731 Bacteria 1273
35 Ga0307413_10102997 3300031824 Bacteria 1891
36 Ga0307410_10039540 3300031852 Bacteria 3097
37 Ga0307412_10153518 3300031911 Bacteria 1702
38 Ga0307416_100035656 3300032002 Bacteria 3803
39 Ga0307414_10121334 3300032004 Bacteria 2010
40 Ga0307414_10395181 3300032004 Bacteria 1199
41 Ga0307411_10021093 3300032005 Bacteria 3804
42 Ga0307415_100064873 3300032126 Bacteria 2542
43 Ga0395901_0083529 3300038443 Bacteria 3338
44 Ga0439465_0086946 3300041413 Bacteria 1066
45 Ga0439465_0120601 3300041413 Bacteria 919
46 Ga0451791_0633932 3300041451 Bacteria 4493
47 Ga0451839_0960879 3300041496 Bacteria 1359
48 Ga0451849_0353571 3300041505 Bacteria 1206
49 Ga0466971_0104834 3300044719 Bacteria 1302
50 Ga0466970_0005275 3300044765 Bacteria 6400
51 Ga0466970_0060841 3300044765 Bacteria 2022
52 Ga0466970_0242748 3300044765 Bacteria 1008
53 Ga0466957_0162576 3300044842 Bacteria 1451
54 Ga0466960_0016508 3300044901 Bacteria 3205
55 Ga0466959_0077925 3300045049 Bacteria 2391
56 Ga0466967_0175659 3300045976 Bacteria 2018
57 Ga0495651_0082729 3300046462 Bacteria 2422
58 Ga0495650_0087760 3300046471 Bacteria 1189
59 Ga0495609_0028339 3300046538 Bacteria 2556
60 Ga0495645_0154071 3300046543 Bacteria 1594
61 Ga0495667_0228422 3300046559 Bacteria 1187
62 Ga0495680_0211408 3300047322 Bacteria 1388
63 Ga0495626_0011678 3300048091 Bacteria 4634
64 Ga0496108_0037760 3300048911 Bacteria 4024
65 Ga0496110_0100891 3300048913 Bacteria 2587
66 Ga0496114_0129014 3300048917 Bacteria 2182
67 Ga0496117_0006684 3300048920 Bacteria 11538
68 Ga0496118_0001736 3300048921 Bacteria 31660
69 Ga0496118_0016409 3300048921 Bacteria 6796
70 Ga0496119_0000133 3300048922 Bacteria 104400
71 Ga0496119_0068733 3300048922 Bacteria 2084
72 Ga0496120_0036428 3300048923 Bacteria 2928
73 Ga0496121_0000098 3300048924 Bacteria 200516
74 Ga0496122_0128787 3300048925 Bacteria 1614
75 Ga0496123_0058099 3300048926 Bacteria 2512
76 Ga0496123_0183339 3300048926 Bacteria 1091
77 Ga0496124_0000075 3300048927 Bacteria 218086
78 Ga0496124_0001613 3300048927 Bacteria 32296
79 Ga0496124_0091658 3300048927 Bacteria 2476
80 Ga0496126_0058873 3300048929 Bacteria 3462
81 Ga0501031_0000752 3300049568 Bacteria 19504
82 Ga0501032_0000977 3300049569 Bacteria 23128
83 Ga0501032_0004829 3300049569 Bacteria 10103
84 Ga0501032_0063888 3300049569 Bacteria 2464
85 Ga0501033_0000299 3300049570 Bacteria 47420
86 Ga0501033_0000432 3300049570 Bacteria 40138
87 Ga0501033_0006979 3300049570 Bacteria 8818
88 Ga0501034_0002016 3300049571 Bacteria 25582
89 Ga0501034_0014265 3300049571 Bacteria 8187
90 Ga0501034_0056843 3300049571 Bacteria 3935
91 Ga0501034_0165053 3300049571 Bacteria 2183
92 Ga0501034_0219901 3300049571 Bacteria 1852
93 Ga0501034_0582698 3300049571 Bacteria 1025
94 Ga0501036_0000209 3300049572 Bacteria 39190
95 Ga0501036_0000867 3300049572 Bacteria 22512
96 Ga0501036_0100853 3300049572 Bacteria 2442
97 Ga0501037_0001157 3300049573 Bacteria 19505
98 Ga0501037_0005900 3300049573 Bacteria 8946
99 Ga0501037_0028990 3300049573 Bacteria 4088
100 Ga0501038_0000675 3300049574 Bacteria 30401
101 Ga0501038_0002147 3300049574 Bacteria 18312
102 Ga0501042_0007670 3300049578 Bacteria 7085
103 Ga0501043_0000378 3300049579 Bacteria 40459
104 Ga0501043_0006581 3300049579 Bacteria 9312
105 Ga0501046_0001013 3300049580 Bacteria 27393
106 Ga0501046_0007960 3300049580 Bacteria 9273
107 Ga0501046_0055342 3300049580 Bacteria 3118
108 Ga0501047_0000312 3300049581 Bacteria 56050
109 Ga0501047_0045312 3300049581 Bacteria 4252
110 Ga0501047_0349919 3300049581 Bacteria 1314
111 Ga0501048_0001346 3300049582 Bacteria 18637
112 Ga0501048_0001393 3300049582 Bacteria 18327
113 Ga0501067_0033333 3300049583 Bacteria 2857
114 Ga0501068_0023769 3300049584 Bacteria 3594
115 Ga0501069_0002264 3300049585 Bacteria 9718
116 Ga0501070_0004635 3300049586 Bacteria 11789
117 Ga0501070_0023262 3300049586 Bacteria 5190
118 Ga0501070_0346783 3300049586 Bacteria 1206
119 Ga0501071_0056961 3300049587 Bacteria 2824
120 Ga0501073_0009341 3300049589 Bacteria 7235
121 Ga0501074_0000833 3300049590 Bacteria 19581
122 Ga0501202_032256 3300049652 Bacteria 1099
123 Ga0501208_027643 3300049655 Bacteria 980
124 Ga0501209_072198 3300049656 Bacteria 983
125 Ga0501080_0006852 3300049742 Bacteria 10278
126 Ga0501080_0010191 3300049742 Bacteria 8594
127 Ga0501083_0040972 3300049744 Bacteria 3142
128 Ga0501035_0001455 3300049822 Bacteria 24260
129 Ga0501035_0002522 3300049822 Bacteria 17914
130 Ga0501044_0002494 3300049823 Bacteria 20994
131 Ga0501044_0023811 3300049823 Bacteria 6507
132 Ga0501044_0170407 3300049823 Bacteria 2149
133 Ga0501045_0001932 3300049824 Bacteria 14003
134 Ga0501045_0365540 3300049824 Bacteria 1074
135 nmdc:mga03683_99070_c1 3300050489 Bacteria 1279
136 nmdc:mga00v17_202316_c1 3300050491 Bacteria 1284
137 nmdc:mga0k408_140666_c1 3300050493 Bacteria 1436
138 nmdc:mga07m45_144236_c1 3300050496 Bacteria 1380
139 nmdc:mga07m45_61608_c1 3300050496 Bacteria 2125
140 Ga0500616_0000268 3300053153 Bacteria 77866
141 Ga0501084_0092338 3300054114 Bacteria 2541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006051 Ga0075364_10047917 Ga0075364_100479172 232
2 3300006177 Ga0075362_10089536 Ga0075362_100895362 232
3 3300006178 Ga0075367_10011543 Ga0075367_100115437 232
4 3300006195 Ga0075366_10182621 Ga0075366_101826212 232
5 3300006353 Ga0075370_10010455 Ga0075370_100104555 232
6 3300050489 nmdc:mga03683_99070_c1 nmdc:mga03683_99070_c1_92_877 232
7 3300050491 nmdc:mga00v17_202316_c1 nmdc:mga00v17_202316_c1_11_796 232
8 3300050493 nmdc:mga0k408_140666_c1 nmdc:mga0k408_140666_c1_353_1138 232
9 3300050496 nmdc:mga07m45_144236_c1 nmdc:mga07m45_144236_c1_317_1102 232
10 3300049571 Ga0501034_0165053 Ga0501034_0165053_1245_2030 233
11 3300025924 Ga0207694_10470597 Ga0207694_104705972 241
12 iso_pu_bacteria 2751185788 2753300400 245
13 iso_pu_bacteria 2928104781 2928108049 245
14 iso_pu_bacteria 2904430863 2904433782 247
15 iso_pu_bacteria 2904501621 2904502312 247
16 iso_pu_bacteria 2908674828 2908677324 247
17 iso_pu_bacteria 2909074476 2909076116 247
18 iso_pu_bacteria 2919039151 2919042210 247
19 iso_pu_bacteria 2928500415 2928502612 247
20 3300003320 rootH2_10038960 rootH2_100389603 249
21 3300046471 Ga0495650_0087760 Ga0495650_0087760_313_1173 249
22 3300046538 Ga0495609_0028339 Ga0495609_0028339_1357_2106 249
23 3300048091 Ga0495626_0011678 Ga0495626_0011678_1796_2545 249
24 3300048920 Ga0496117_0006684 Ga0496117_0006684_10529_11332 249
25 3300048921 Ga0496118_0001736 Ga0496118_0001736_622_1425 249
26 3300048922 Ga0496119_0068733 Ga0496119_0068733_509_1312 249
27 3300048923 Ga0496120_0036428 Ga0496120_0036428_986_1789 249
28 3300048926 Ga0496123_0058099 Ga0496123_0058099_1091_1894 249
29 3300048926 Ga0496123_0183339 Ga0496123_0183339_186_935 249
30 3300048927 Ga0496124_0000075 Ga0496124_0000075_81086_81889 249
31 3300048927 Ga0496124_0001613 Ga0496124_0001613_13824_14573 249
32 3300050496 nmdc:mga07m45_61608_c1 nmdc:mga07m45_61608_c1_1191_1973 249
33 3300048925 Ga0496122_0128787 Ga0496122_0128787_243_1049 250
34 3300003323 rootH1_10204138 rootH1_102041382 251
35 3300048927 Ga0496124_0091658 Ga0496124_0091658_1132_1950 251
36 3300005344 Ga0070661_100256755 Ga0070661_1002567552 252
37 3300031731 Ga0307405_10270988 Ga0307405_102709882 252
38 3300031824 Ga0307413_10102997 Ga0307413_101029971 252
39 3300031911 Ga0307412_10153518 Ga0307412_101535181 252
40 iso_pu_bacteria 2857729791 2857731521 252
41 3300031548 Ga0307408_100239710 Ga0307408_1002397102 253
42 3300031852 Ga0307410_10039540 Ga0307410_100395403 253
43 3300032002 Ga0307416_100035656 Ga0307416_1000356564 253
44 3300032004 Ga0307414_10121334 Ga0307414_101213342 253
45 3300032005 Ga0307411_10021093 Ga0307411_100210933 253
46 3300032126 Ga0307415_100064873 Ga0307415_1000648733 253
47 3300044901 Ga0466960_0016508 Ga0466960_0016508_275_1171 253
48 3300049652 Ga0501202_032256 Ga0501202_032256_231_992 253
49 3300049655 Ga0501208_027643 Ga0501208_027643_49_810 253
50 3300049656 Ga0501209_072198 Ga0501209_072198_72_833 253
51 3300003760 Ga0055527_1000003 Ga0055527_1000003297 254
52 3300003762 Ga0055542_1000005 Ga0055542_1000005161 254
53 3300003763 Ga0055529_1000006 Ga0055529_1000006297 254
54 3300005327 Ga0070658_10171557 Ga0070658_101715572 254
55 3300025228 Ga0209672_100003 Ga0209672_1000031136 254
56 3300025229 Ga0209147_100511 Ga0209147_10051112 254
57 3300025242 Ga0209258_103707 Ga0209258_1037073 254
58 3300025254 Ga0209148_1000004 Ga0209148_10000041431 254
59 3300025272 Ga0209455_1000091 Ga0209455_1000091102 254
60 3300044765 Ga0466970_0005275 Ga0466970_0005275_2564_3376 254
61 3300044765 Ga0466970_0060841 Ga0466970_0060841_1166_1930 254
62 3300048922 Ga0496119_0000133 Ga0496119_0000133_11319_12083 254
63 3300009036 Ga0105244_10159893 Ga0105244_101598931 256
64 3300025728 Ga0207655_1091140 Ga0207655_10911401 256
65 iso_pu_bacteria 2848551377 2848554685 256
66 iso_pu_bacteria 2919042368 2919044170 256
67 iso_pu_bacteria 2984551494 2984552522 256
68 3300049569 Ga0501032_0000977 Ga0501032_0000977_8947_9759 257
69 3300049570 Ga0501033_0000432 Ga0501033_0000432_10217_11029 257
70 3300049571 Ga0501034_0002016 Ga0501034_0002016_10112_10924 257
71 3300049572 Ga0501036_0000209 Ga0501036_0000209_27847_28659 257
72 3300049573 Ga0501037_0001157 Ga0501037_0001157_6443_7255 257
73 3300049574 Ga0501038_0002147 Ga0501038_0002147_10927_11739 257
74 3300049578 Ga0501042_0007670 Ga0501042_0007670_835_1647 257
75 3300049579 Ga0501043_0000378 Ga0501043_0000378_10211_11023 257
76 3300049580 Ga0501046_0001013 Ga0501046_0001013_14301_15113 257
77 3300049581 Ga0501047_0000312 Ga0501047_0000312_23853_24665 257
78 3300049582 Ga0501048_0001393 Ga0501048_0001393_10420_11232 257
79 3300049586 Ga0501070_0023262 Ga0501070_0023262_2704_3516 257
80 3300049589 Ga0501073_0009341 Ga0501073_0009341_3300_4112 257
81 3300049742 Ga0501080_0006852 Ga0501080_0006852_2664_3476 257
82 3300049822 Ga0501035_0001455 Ga0501035_0001455_14003_14815 257
83 3300049823 Ga0501044_0002494 Ga0501044_0002494_14124_14936 257
84 3300049824 Ga0501045_0001932 Ga0501045_0001932_9636_10448 257
85 iso_pu_bacteria 2643221629 2644164260 257
86 iso_pu_bacteria 2643221662 2644348070 257
87 3300038443 Ga0395901_0083529 Ga0395901_0083529_2264_3040 258
88 3300044842 Ga0466957_0162576 Ga0466957_0162576_458_1234 258
89 3300044719 Ga0466971_0104834 Ga0466971_0104834_89_868 259
90 3300045049 Ga0466959_0077925 Ga0466959_0077925_1448_2227 259
91 3300049568 Ga0501031_0000752 Ga0501031_0000752_7040_7849 259
92 3300049569 Ga0501032_0004829 Ga0501032_0004829_6963_7772 259
93 3300049570 Ga0501033_0006979 Ga0501033_0006979_4786_5595 259
94 3300049571 Ga0501034_0014265 Ga0501034_0014265_7076_7885 259
95 3300049572 Ga0501036_0000867 Ga0501036_0000867_14313_15122 259
96 3300049573 Ga0501037_0005900 Ga0501037_0005900_6967_7776 259
97 3300049574 Ga0501038_0000675 Ga0501038_0000675_26452_27261 259
98 3300049579 Ga0501043_0006581 Ga0501043_0006581_5840_6649 259
99 3300049580 Ga0501046_0055342 Ga0501046_0055342_1875_2684 259
100 3300049581 Ga0501047_0045312 Ga0501047_0045312_303_1112 259
101 3300049582 Ga0501048_0001346 Ga0501048_0001346_7168_7977 259
102 3300049584 Ga0501068_0023769 Ga0501068_0023769_875_1684 259
103 3300049585 Ga0501069_0002264 Ga0501069_0002264_1771_2580 259
104 3300049586 Ga0501070_0004635 Ga0501070_0004635_5141_5950 259
105 3300049586 Ga0501070_0346783 Ga0501070_0346783_164_943 259
106 3300049587 Ga0501071_0056961 Ga0501071_0056961_1333_2142 259
107 3300049590 Ga0501074_0000833 Ga0501074_0000833_11639_12448 259
108 3300049742 Ga0501080_0010191 Ga0501080_0010191_2645_3454 259
109 3300049744 Ga0501083_0040972 Ga0501083_0040972_1904_2713 259
110 3300049822 Ga0501035_0002522 Ga0501035_0002522_3141_3950 259
111 3300049823 Ga0501044_0023811 Ga0501044_0023811_4528_5337 259
112 3300049824 Ga0501045_0365540 Ga0501045_0365540_38_847 259
113 3300054114 Ga0501084_0092338 Ga0501084_0092338_435_1244 259
114 3300041413 Ga0439465_0086946 Ga0439465_0086946_11_793 260
115 3300045976 Ga0466967_0175659 Ga0466967_0175659_40_822 260
116 3300048924 Ga0496121_0000098 Ga0496121_0000098_106735_107523 260
117 iso_pu_bacteria 2799112218 2799183686 260
118 3300005539 Ga0068853_100058940 Ga0068853_1000589403 261
119 3300032004 Ga0307414_10395181 Ga0307414_103951812 261
120 3300041413 Ga0439465_0120601 Ga0439465_0120601_54_839 261
121 3300044765 Ga0466970_0242748 Ga0466970_0242748_205_996 261
122 3300049571 Ga0501034_0219901 Ga0501034_0219901_796_1581 261
123 3300049571 Ga0501034_0582698 Ga0501034_0582698_12_797 261
124 iso_pu_bacteria 2515154155 2515857187 261
125 iso_pu_bacteria 2675903058 2676473730 261
126 iso_pu_bacteria 2827628540 2827632387 261
127 3300005937 Ga0081455_10055652 Ga0081455_100556521 263
128 3300005337 Ga0070682_100141594 Ga0070682_1001415942 264
129 3300005563 Ga0068855_100122431 Ga0068855_1001224313 264
130 3300005842 Ga0068858_100280919 Ga0068858_1002809191 264
131 3300013307 Ga0157372_10936400 Ga0157372_109364001 264
132 3300025949 Ga0207667_10304445 Ga0207667_103044452 264
133 3300046462 Ga0495651_0082729 Ga0495651_0082729_292_1086 264
134 3300046559 Ga0495667_0228422 Ga0495667_0228422_253_1047 264
135 3300047322 Ga0495680_0211408 Ga0495680_0211408_577_1371 264
136 3300048911 Ga0496108_0037760 Ga0496108_0037760_2716_3510 264
137 3300048913 Ga0496110_0100891 Ga0496110_0100891_1736_2530 264
138 3300048921 Ga0496118_0016409 Ga0496118_0016409_2370_3164 264
139 3300049823 Ga0501044_0170407 Ga0501044_0170407_77_871 264
140 3300053153 Ga0500616_0000268 Ga0500616_0000268_28731_29525 264
141 3300017792 Ga0163161_10566539 Ga0163161_105665391 265
142 3300026142 Ga0207698_10322245 Ga0207698_103222452 265
143 3300041451 Ga0451791_0633932 Ga0451791_0633932_3573_4370 265
144 3300041496 Ga0451839_0960879 Ga0451839_0960879_529_1326 265
145 3300041505 Ga0451849_0353571 Ga0451849_0353571_139_939 265
146 3300046543 Ga0495645_0154071 Ga0495645_0154071_105_902 265
147 3300048917 Ga0496114_0129014 Ga0496114_0129014_1250_2047 265
148 3300049580 Ga0501046_0007960 Ga0501046_0007960_7782_8741 268
149 3300049581 Ga0501047_0349919 Ga0501047_0349919_176_1135 268
150 3300049569 Ga0501032_0063888 Ga0501032_0063888_1536_2345 269
151 3300049571 Ga0501034_0056843 Ga0501034_0056843_1561_2370 269
152 3300049573 Ga0501037_0028990 Ga0501037_0028990_1549_2358 269
153 3300005563 Ga0068855_100206758 Ga0068855_1002067582 270
154 3300025949 Ga0207667_10174639 Ga0207667_101746392 270
155 3300048929 Ga0496126_0058873 Ga0496126_0058873_504_1316 270
156 3300049570 Ga0501033_0000299 Ga0501033_0000299_10713_11525 270
157 3300049572 Ga0501036_0100853 Ga0501036_0100853_1221_2033 270
158 3300049583 Ga0501067_0033333 Ga0501067_0033333_126_1016 272
159 3300000549 LJQas_1004966 LJQas_10049662 278

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

217

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

265

0.95

PF08659

KR

KR domain

30

189

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

32

256

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9638 4 247
4ijk-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from helicobacter pylori 26695 0.9594 8 248
5cdy-assembly1.cif.gz_C the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9558 4 247
5cdy-assembly1.cif.gz_D the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9544 4 247
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9501 4 247
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9533 1 183 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9511 5 183 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9492 8 248 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9475 7 244 3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9419 5 190 3.40.50.720
ID Description Score Start End GO Terms
AF-H0PZN4-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase 0.9773 35 138
AF-A0A7C3JPF9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9722 4 129 GO:0016491
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.969 5 92
AF-A0A7W1NW92-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9672 5 132
AF-A0A7V4JF01-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9668 5 189 GO:0016616
GO:0030497

Feature Viewer

pLDDT pTM Quality
86.25 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map