F233111

General Info

Members Datasets Scaffolds Average Seq Length
159 136 318 134

Family's Representative Sequence

Representative Sequence 3300049537|Ga0501321_074168|Ga0501321_074168_14_481
Length 155
Sequence MAETYRSGFQSVPVEQVEAGRMLQLSRFQQLRYIIVPQAMRQQLPVILSLNISLFKDTALVSTIAVADLPRQGRATYELIRQGGPFPYDKDGSVFGNRERLLPAAPRGYWREYTVATPGSRDRGARRIVCGGPQRRPDACFYTADHYASFRKIVE

Samples

Sample ID Description Type Environment
1 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
18 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
29 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
48 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
53 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
54 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
71 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
72 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
73 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
74 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
75 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
76 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
77 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
78 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
79 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
80 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
81 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
82 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
85 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
86 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
89 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
90 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
94 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
95 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
105 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
111 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
112 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
118 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 2547132374 Acidovorax radicis N35 Isolate Unclassified
123 2643221570 Acidovorax sp. Root568 Isolate Unclassified
124 2643221596 Acidovorax sp. Root70 Isolate Unclassified
125 2643221609 Acidovorax sp. Root217 Isolate Unclassified
126 2643221611 Acidovorax sp. Root219 Isolate Unclassified
127 2643221652 Acidovorax sp. Root402 Isolate Unclassified
128 2643221717 Acidovorax sp. Root267 Isolate Unclassified
129 2721755523 Delftia sp. HK171 Isolate Unclassified
130 2738543012 Acidovorax sp. CF301 Isolate Unclassified
131 2816332133 Acidovorax radicis 2721A Isolate Unclassified
132 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
133 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
134 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
135 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
136 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.21
Metatranscriptomes 16.35
Isolates 9.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.18
Nodule 1.26
Rhizoplane 0.63
Rhizosphere 79.87
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501321_074168 3300049537 Bacteria 534
2 Ga0007416J51690_1072746 3300003577 Bacteria 1416
3 Ga0055540_1002530 3300003792 Bacteria 9545
4 Ga0055531_10001635 3300003794 Bacteria 16229
5 Ga0068868_100421688 3300005338 Bacteria 1155
6 Ga0068867_100725853 3300005459 Bacteria 879
7 Ga0070679_100191852 3300005530 Bacteria 2012
8 Ga0068855_100757957 3300005563 Bacteria 1034
9 Ga0068856_100095879 3300005614 Bacteria 2955
10 Ga0070702_101091467 3300005615 Bacteria 637
11 Ga0068863_100121436 3300005841 Bacteria 2492
12 Ga0068862_100416226 3300005844 Bacteria 1260
13 Ga0075363_100154170 3300006048 Bacteria 1298
14 Ga0075364_10026448 3300006051 Bacteria 3702
15 Ga0075366_10014433 3300006195 Bacteria 4512
16 Ga0075370_10095403 3300006353 Bacteria 1718
17 Ga0079104_1000008 3300006946 Bacteria 371223
18 Ga0105250_10000385 3300009092 Bacteria 32922
19 Ga0105245_10030989 3300009098 Bacteria 4730
20 Ga0105243_10022569 3300009148 Bacteria 4785
21 Ga0105242_10000643 3300009176 Bacteria 27310
22 Ga0105248_10238403 3300009177 Bacteria 2047
23 Ga0105238_10101913 3300009551 Bacteria 2853
24 Ga0105239_10129173 3300010375 Bacteria 2809
25 Ga0105246_10114594 3300011119 Bacteria 1986
26 Ga0105246_10382038 3300011119 Bacteria 1164
27 Ga0157378_10074526 3300013297 Bacteria 3054
28 Ga0157378_12269468 3300013297 Bacteria 594
29 Ga0157372_13044728 3300013307 Bacteria 536
30 Ga0182006_1129430 3300015261 Bacteria 869
31 Ga0206351_10420473 3300020077 Bacteria 1021
32 Ga0209673_1035378 3300025273 Bacteria 1496
33 Ga0209051_1000351 3300025303 Bacteria 68445
34 Ga0209257_1000015 3300025304 Bacteria 908141
35 Ga0207696_1000284 3300025711 Bacteria 59551
36 Ga0207655_1087622 3300025728 Bacteria 1104
37 Ga0207660_10147890 3300025917 Bacteria 1802
38 Ga0207652_10093782 3300025921 Bacteria 2642
39 Ga0207652_10384510 3300025921 Bacteria 1266
40 Ga0207694_10029609 3300025924 Bacteria 4178
41 Ga0207687_10136842 3300025927 Bacteria 1853
42 Ga0207686_10006494 3300025934 Bacteria 6296
43 Ga0207709_10000121 3300025935 Bacteria 116804
44 Ga0207711_10171297 3300025941 Bacteria 1970
45 Ga0207689_10017775 3300025942 Bacteria 6008
46 Ga0207667_10020260 3300025949 Bacteria 7402
47 Ga0207677_10031513 3300026023 Bacteria 3396
48 Ga0207641_10055081 3300026088 Bacteria 3377
49 Ga0207648_11362263 3300026089 Bacteria 667
50 Ga0209281_1000029 3300027111 Bacteria 431495
51 Ga0209973_1013339 3300027252 Bacteria 1011
52 Ga0209974_10004937 3300027876 Bacteria 4718
53 Ga0209974_10115601 3300027876 Bacteria 947
54 Ga0268265_10486445 3300028380 Bacteria 1160
55 Ga0307515_10000222 3300028794 Bacteria 140902
56 Ga0265330_10053780 3300031235 Bacteria 1761
57 Ga0265332_10043201 3300031238 Bacteria 1946
58 Ga0265329_10013296 3300031242 Bacteria 2939
59 Ga0265331_10101271 3300031250 Bacteria 1325
60 Ga0307513_10016683 3300031456 Bacteria 8842
61 Ga0307408_100183253 3300031548 Bacteria 1681
62 Ga0307408_100426944 3300031548 Bacteria 1144
63 Ga0307514_10001498 3300031649 Bacteria 28071
64 Ga0265314_10000481 3300031711 Bacteria 52341
65 Ga0265342_10064791 3300031712 Bacteria 2143
66 Ga0307406_10000629 3300031901 Bacteria 20149
67 Ga0307406_10251512 3300031901 Bacteria 1332
68 Ga0307416_100233735 3300032002 Bacteria 1774
69 Ga0307416_100642806 3300032002 Bacteria 1145
70 Ga0307416_101691232 3300032002 Bacteria 737
71 Ga0307411_10726326 3300032005 Bacteria 868
72 Ga0373958_0069419 3300034819 Bacteria 779
73 Ga0373931_0075440 3300035691 Bacteria 1849
74 Ga0395900_0028847 3300037418 Bacteria 5688
75 Ga0395900_0857877 3300037418 Bacteria 833
76 Ga0395900_1056991 3300037418 Bacteria 730
77 Ga0395898_0019567 3300037466 Bacteria 6888
78 Ga0395905_0040302 3300037471 Bacteria 4381
79 Ga0395905_0322157 3300037471 Bacteria 1435
80 Ga0395901_0014000 3300038443 Bacteria 8162
81 Ga0395901_0297803 3300038443 Bacteria 1673
82 Ga0395901_0324589 3300038443 Bacteria 1592
83 Ga0439453_0004186 3300041408 Bacteria 2131
84 Ga0439461_0028817 3300041410 Bacteria 1146
85 Ga0439437_021853 3300042000 Bacteria 777
86 Ga0439443_008116 3300042003 Bacteria 1474
87 Ga0439457_068462 3300042014 Bacteria 808
88 Ga0450917_007703 3300042120 Bacteria 824
89 Ga0450923_019925 3300042125 Bacteria 1296
90 Ga0450898_015614 3300042134 Bacteria 1288
91 Ga0450899_050342 3300042135 Bacteria 531
92 Ga0450909_005531 3300042185 Bacteria 1816
93 Ga0439434_0093126 3300042435 Bacteria 965
94 Ga0439444_0116338 3300042437 Bacteria 620
95 Ga0453683_0780702 3300044673 Unclassified 628
96 Ga0466960_0776563 3300044901 Bacteria 579
97 Ga0451576_0096791 3300045051 Bacteria 3070
98 Ga0495663_0071149 3300046525 Bacteria 1107
99 Ga0495642_0058437 3300046528 Bacteria 1596
100 Ga0495652_0282423 3300046529 Bacteria 1215
101 Ga0495621_0010826 3300046539 Bacteria 2805
102 Ga0495656_0015186 3300046615 Bacteria 2903
103 Ga0495656_0015191 3300046615 Bacteria 2903
104 Ga0495659_0448794 3300046664 Bacteria 561
105 Ga0495669_0065273 3300046684 Bacteria 1652
106 Ga0495636_0029160 3300047318 Bacteria 2252
107 Ga0495677_0107172 3300047445 Bacteria 1060
108 Ga0495614_0543894 3300048089 Bacteria 555
109 Ga0495615_0069238 3300048090 Bacteria 947
110 Ga0496108_0219721 3300048911 Bacteria 1651
111 Ga0496122_0249406 3300048925 Bacteria 994
112 Ga0501306_039182 3300049127 Bacteria 730
113 Ga0501306_083272 3300049127 Bacteria 554
114 Ga0501308_033768 3300049128 Bacteria 697
115 Ga0501309_045546 3300049129 Bacteria 679
116 Ga0501341_16454 3300049131 Bacteria 525
117 Ga0501305_027484 3300049161 Bacteria 872
118 Ga0501305_037173 3300049161 Bacteria 781
119 Ga0501305_040839 3300049161 Bacteria 754
120 Ga0501305_113116 3300049161 Bacteria 515
121 Ga0501307_018616 3300049162 Bacteria 885
122 Ga0501307_061170 3300049162 Bacteria 584
123 Ga0501300_076907 3300049523 Bacteria 546
124 Ga0501311_098339 3300049527 Bacteria 515
125 Ga0501312_013531 3300049528 Bacteria 1136
126 Ga0501312_016589 3300049528 Bacteria 1055
127 Ga0501312_123390 3300049528 Bacteria 503
128 Ga0501313_043145 3300049529 Bacteria 610
129 Ga0501321_006910 3300049537 Bacteria 1167
130 Ga0501323_051085 3300049539 Bacteria 627
131 Ga0501323_058597 3300049539 Bacteria 597
132 Ga0501047_0128961 3300049581 Bacteria 2409
133 Ga0501248_027967 3300049678 Bacteria 627
134 Ga0501257_062636 3300049686 Bacteria 941
135 Ga0501263_050764 3300049760 Bacteria 630
136 nmdc:mga03n38_346967_c1 3300050490 Bacteria 807
137 nmdc:mga00v17_21453_c1 3300050491 Bacteria 3713
138 nmdc:mga0k408_34712_c1 3300050493 Bacteria 2889
139 nmdc:mga07m45_41214_c1 3300050496 Bacteria 2585
140 Ga0590075_031449 3300059424 Bacteria 1346
141 Ga0587070_030282 3300059491 Bacteria 976
142 Ga0587090_017009 3300059510 Bacteria 1093
143 Ga0587107_079513 3300059652 Bacteria 614
144 Ga0587111_0012981 3300060346 Bacteria 1481
145 2548500560 2547132374 Bacteria 5530232
146 2643864439 2643221570 Bacteria 5103772
147 2643992938 2643221596 Bacteria 5006805
148 2644058093 2643221609 Bacteria 6756331
149 2644073129 2643221611 Bacteria 6820941
150 2644291871 2643221652 Bacteria 5140275
151 2644646892 2643221717 Bacteria 5676132
152 2722886559 2721755523 Bacteria 6430384
153 2739242384 2738543012 Bacteria 7115078
154 2816469999 2816332133 Bacteria 7249298
155 2839144474 2839138175 Bacteria 6549354
156 2842720734 2842718218 Bacteria 4560148
157 2881104444 2881101125 Bacteria 4590519
158 2974321538 2974320154 Bacteria 4571377
159 2990715020 2990710928 Bacteria 5002431
160 Ga0501321_074168
161 Ga0007416J51690_1072746
162 Ga0055540_1002530
163 Ga0055531_10001635
164 Ga0068868_100421688
165 Ga0068867_100725853
166 Ga0070679_100191852
167 Ga0068855_100757957
168 Ga0068856_100095879
169 Ga0070702_101091467
170 Ga0068863_100121436
171 Ga0068862_100416226
172 Ga0075363_100154170
173 Ga0075364_10026448
174 Ga0075366_10014433
175 Ga0075370_10095403
176 Ga0079104_1000008
177 Ga0105250_10000385
178 Ga0105245_10030989
179 Ga0105243_10022569
180 Ga0105242_10000643
181 Ga0105248_10238403
182 Ga0105238_10101913
183 Ga0105239_10129173
184 Ga0105246_10114594
185 Ga0105246_10382038
186 Ga0157378_10074526
187 Ga0157378_12269468
188 Ga0157372_13044728
189 Ga0182006_1129430
190 Ga0206351_10420473
191 Ga0209673_1035378
192 Ga0209051_1000351
193 Ga0209257_1000015
194 Ga0207696_1000284
195 Ga0207655_1087622
196 Ga0207660_10147890
197 Ga0207652_10093782
198 Ga0207652_10384510
199 Ga0207694_10029609
200 Ga0207687_10136842
201 Ga0207686_10006494
202 Ga0207709_10000121
203 Ga0207711_10171297
204 Ga0207689_10017775
205 Ga0207667_10020260
206 Ga0207677_10031513
207 Ga0207641_10055081
208 Ga0207648_11362263
209 Ga0209281_1000029
210 Ga0209973_1013339
211 Ga0209974_10004937
212 Ga0209974_10115601
213 Ga0268265_10486445
214 Ga0307515_10000222
215 Ga0265330_10053780
216 Ga0265332_10043201
217 Ga0265329_10013296
218 Ga0265331_10101271
219 Ga0307513_10016683
220 Ga0307408_100183253
221 Ga0307408_100426944
222 Ga0307514_10001498
223 Ga0265314_10000481
224 Ga0265342_10064791
225 Ga0307406_10000629
226 Ga0307406_10251512
227 Ga0307416_100233735
228 Ga0307416_100642806
229 Ga0307416_101691232
230 Ga0307411_10726326
231 Ga0373958_0069419
232 Ga0373931_0075440
233 Ga0395900_0028847
234 Ga0395900_0857877
235 Ga0395900_1056991
236 Ga0395898_0019567
237 Ga0395905_0040302
238 Ga0395905_0322157
239 Ga0395901_0014000
240 Ga0395901_0297803
241 Ga0395901_0324589
242 Ga0439453_0004186
243 Ga0439461_0028817
244 Ga0439437_021853
245 Ga0439443_008116
246 Ga0439457_068462
247 Ga0450917_007703
248 Ga0450923_019925
249 Ga0450898_015614
250 Ga0450899_050342
251 Ga0450909_005531
252 Ga0439434_0093126
253 Ga0439444_0116338
254 Ga0453683_0780702
255 Ga0466960_0776563
256 Ga0451576_0096791
257 Ga0495663_0071149
258 Ga0495642_0058437
259 Ga0495652_0282423
260 Ga0495621_0010826
261 Ga0495656_0015186
262 Ga0495656_0015191
263 Ga0495659_0448794
264 Ga0495669_0065273
265 Ga0495636_0029160
266 Ga0495677_0107172
267 Ga0495614_0543894
268 Ga0495615_0069238
269 Ga0496108_0219721
270 Ga0496122_0249406
271 Ga0501306_039182
272 Ga0501306_083272
273 Ga0501308_033768
274 Ga0501309_045546
275 Ga0501341_16454
276 Ga0501305_027484
277 Ga0501305_037173
278 Ga0501305_040839
279 Ga0501305_113116
280 Ga0501307_018616
281 Ga0501307_061170
282 Ga0501300_076907
283 Ga0501311_098339
284 Ga0501312_013531
285 Ga0501312_016589
286 Ga0501312_123390
287 Ga0501313_043145
288 Ga0501321_006910
289 Ga0501323_051085
290 Ga0501323_058597
291 Ga0501047_0128961
292 Ga0501248_027967
293 Ga0501257_062636
294 Ga0501263_050764
295 nmdc:mga03n38_346967_c1
296 nmdc:mga00v17_21453_c1
297 nmdc:mga0k408_34712_c1
298 nmdc:mga07m45_41214_c1
299 Ga0590075_031449
300 Ga0587070_030282
301 Ga0587090_017009
302 Ga0587107_079513
303 Ga0587111_0012981
304 2548500560
305 2643864439
306 2643992938
307 2644058093
308 2644073129
309 2644291871
310 2644646892
311 2722886559
312 2739242384
313 2816469999
314 2839144474
315 2842720734
316 2881104444
317 2974321538
318 2990715020

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00545

Ribonuclease

ribonuclease

55

154

0.94

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

1

84

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d4a-assembly3.cif.gz_C crystal structure of ribonuclease sa2 with 3'-gmp obtained by ligand diffusion 0.8581 42 134
3d5i-assembly3.cif.gz_C crystal structure of ribonuclease sa2 with exo-2',3'-cyclophosphorotioate 0.8576 42 134
3dgy-assembly3.cif.gz_C crystal structure of ribonuclease sa2 with guanosine-2'-cyclophosphate 0.8537 42 134
4j5g-assembly3.cif.gz_B-2 crystal structure analysis of streptomyces aureofaciens ribonuclease sa t95a mutant 0.8527 41 135
3d5g-assembly3.cif.gz_C structure of ribonuclease sa2 complexes with mononucleotides: new aspects of catalytic reaction and substrate recognition 0.8526 40 135
ID Description Score Start End Superfamily
3d5gB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Microbial ribonucleases 0.8422 40 134 3.10.450.30
1c54A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Microbial ribonucleases 0.8071 40 135 3.10.450.30
3d5gB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Microbial ribonucleases 0.7865 40 134 3.10.450.30
1c54A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Microbial ribonucleases 0.7702 40 135 3.10.450.30
af_F1QUL1_24_96_3.10.320.10 Alpha Beta;Roll;Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1;Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 0.6784 89 123 3.10.320.10
ID Description Score Start End GO Terms
AF-C5T7Y3-F1-model_v4 Guanine-specific ribonuclease N1 and T1 0.8904 41 135 GO:0003723
GO:0004521
AF-C5T7Y3-F1-model_v4 Guanine-specific ribonuclease N1 and T1 0.8816 41 135 GO:0003723
GO:0004521
AF-A0A2I6SAR9-F1-model_v4 Ribonuclease 0.8815 40 135 GO:0003723
GO:0004521
AF-A0A7G8VQ86-F1-model_v4 Guanine-specific ribonuclease N1 and T1 0.88 43 135 GO:0003723
GO:0004521
AF-A0A257DCZ5-F1-model_v4 Ribonuclease 0.8771 40 135 GO:0003723
GO:0004521

Map