F232249

General Info

Members Datasets Scaffolds Average Seq Length
159 125 133 202

Family's Representative Sequence

Representative Sequence 3300015261|Ga0182006_1035478|Ga0182006_10354782
Length 216
Sequence LRHPRADLAGLSAMRLDLLPALWREVPTLRGRHASLEPLQAAHADALRAALHGSGLERLWYTSVPSADQVDGYVAAALEAQAQGLALPFVVRDAAGEIVGCTRFYGLDAEVPTLLIGYTWYAPRVQRTGVNTEVKRMLLQYAFETLRCISVGFETSWFNHTSRAAIARLGAKQDGVLRNHKRHADGTPRDTVVFSIIDTEWAGVKRHLQFRLDSHT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2643221573 Lysobacter sp. Root604 Isolate Unclassified
4 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
5 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
6 2643221720 Lysobacter sp. Root916 Isolate Unclassified
7 2643221728 Lysobacter sp. Root983 Isolate Unclassified
8 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
9 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
10 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
11 2818991457 Xanthomonas translucens 569 Isolate Unclassified
12 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
13 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
14 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
15 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
16 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
17 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
18 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
19 2919513703 Luteimonas sp. 3794 Isolate Unclassified
20 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
21 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
22 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
23 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
44 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
45 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
80 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
81 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
82 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
83 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
84 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
85 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
86 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
87 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
88 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
89 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
92 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
96 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
97 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
100 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
113 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
114 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
115 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
116 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
117 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
118 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
122 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
123 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
124 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
125 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.65
Metatranscriptomes 0
Isolates 16.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.84
Nodule 1.26
Rhizoplane 7.55
Rhizosphere 51.57
Stem 0
Stem Tuber 0
Unclassified 25.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2636914 2162886007 Bacteria 5158
2 SwRhRL2b_contig_2665444 2162886007 Bacteria 4157
3 SwRhRL2b_contig_3437389 2162886007 Bacteria 2215
4 SwRhRL2b_contig_723762 2162886007 Bacteria 4988
5 JGI25152J39213_1000035 3300002773 Bacteria 93806
6 JGI25150J39212_1000506 3300002774 Bacteria 16142
7 JGI25151J46595_10000057 3300003187 Bacteria 151052
8 JGI25153J46596_10000041 3300003215 Bacteria 162103
9 rootH1_10025459 3300003316 Bacteria 4344
10 rootH2_10056373 3300003320 Bacteria 3300
11 rootH1_10149252 3300003323 Bacteria 1328
12 Ga0055536_1002005 3300003781 Bacteria 11676
13 Ga0055536_1005557 3300003781 Bacteria 6127
14 Ga0058692_1000006 3300003856 Bacteria 398109
15 Ga0058692_1000012 3300003856 Bacteria 318930
16 Ga0065704_10070476 3300005289 Bacteria 23424
17 Ga0070670_100196359 3300005331 Bacteria 1753
18 Ga0070680_100365022 3300005336 Bacteria 1228
19 Ga0070668_100047736 3300005347 Bacteria 3292
20 Ga0070669_100040241 3300005353 Bacteria 3398
21 Ga0068852_100154644 3300005616 Bacteria 2135
22 Ga0081539_10014367 3300005985 Bacteria 5862
23 Ga0075364_10019062 3300006051 Bacteria 4304
24 Ga0075369_10006432 3300006186 Bacteria 4441
25 Ga0105251_10000437 3300009011 Bacteria 40388
26 Ga0105243_10004981 3300009148 Bacteria 10410
27 Ga0105148_102160 3300009978 Bacteria 1383
28 Ga0105029_104002 3300009984 Bacteria 1003
29 Ga0105028_106484 3300009993 Bacteria 1221
30 Ga0157372_10259688 3300013307 Bacteria 2017
31 Ga0182006_1035478 3300015261 Bacteria 1988
32 Ga0182006_1070458 3300015261 Bacteria 1298
33 Ga0182005_1008185 3300015265 Bacteria 3093
34 Ga0183360_10001 3300015689 Bacteria 3943671
35 Ga0207425_1000044 3300025245 Bacteria 195202
36 Ga0209129_1000044 3300025258 Bacteria 298971
37 Ga0209676_1000034 3300025292 Bacteria 460125
38 Ga0209676_1000279 3300025292 Bacteria 106358
39 Ga0209025_1000012 3300025294 Bacteria 924362
40 Ga0209758_1000018 3300025297 Bacteria 753320
41 Ga0209050_1012881 3300025298 Bacteria 3783
42 Ga0209257_1000645 3300025304 Bacteria 55704
43 Ga0209257_1025607 3300025304 Bacteria 2011
44 Ga0207713_1005987 3300025735 Bacteria 7499
45 Ga0207649_10431304 3300025920 Bacteria 991
46 Ga0207681_10170431 3300025923 Bacteria 1649
47 Ga0207650_10011996 3300025925 Bacteria 5974
48 Ga0207709_10007378 3300025935 Bacteria 6126
49 Ga0207668_10140529 3300025972 Bacteria 1856
50 Ga0207683_10109536 3300026121 Bacteria 2472
51 Ga0209371_1000007 3300027312 Bacteria 1050654
52 Ga0209371_1000016 3300027312 Bacteria 646301
53 Ga0209282_1312237 3300027666 Bacteria 662
54 Ga0268256_1000008 3300030500 Bacteria 1050654
55 Ga0268256_1000015 3300030500 Bacteria 646300
56 Ga0316176_1196417 3300030732 Bacteria 1260
57 Ga0307513_10039853 3300031456 Bacteria 5202
58 Ga0307405_10297080 3300031731 Bacteria 1223
59 Ga0307413_10000718 3300031824 Bacteria 11373
60 Ga0307413_10345886 3300031824 Bacteria 1145
61 Ga0307413_10832382 3300031824 Bacteria 778
62 Ga0307407_10199349 3300031903 Bacteria 1340
63 Ga0307412_10100670 3300031911 Bacteria 2043
64 Ga0307416_100942718 3300032002 Bacteria 965
65 Ga0307414_10004643 3300032004 Bacteria 7480
66 Ga0307414_10038558 3300032004 Bacteria 3210
67 Ga0307414_10041317 3300032004 Bacteria 3123
68 Ga0307414_10059198 3300032004 Bacteria 2703
69 Ga0307414_10091158 3300032004 Bacteria 2264
70 Ga0307414_10303453 3300032004 Bacteria 1352
71 Ga0307411_10398104 3300032005 Bacteria 1137
72 Ga0307415_100356765 3300032126 Bacteria 1233
73 Ga0395900_0027260 3300037418 Bacteria 5850
74 Ga0395898_0349525 3300037466 Bacteria 1410
75 Ga0237819_00013 3300038705 Bacteria 59823
76 Ga0237819_15055 3300038705 Bacteria 897
77 Ga0439439_0050240 3300041406 Bacteria 1092
78 Ga0439465_0048972 3300041413 Bacteria 1379
79 Ga0439465_0084559 3300041413 Bacteria 1079
80 Ga0451791_1336134 3300041451 Bacteria 1977
81 Ga0451791_1607435 3300041451 Bacteria 665
82 Ga0451793_0723539 3300041452 Bacteria 3691
83 Ga0451797_0162532 3300041453 Bacteria 2193
84 Ga0451797_1535257 3300041453 Bacteria 1203
85 Ga0451800_0163290 3300041459 Bacteria 12437
86 Ga0451802_0605770 3300041460 Bacteria 1679
87 Ga0451806_619891 3300041462 Bacteria 4955
88 Ga0451807_0953828 3300041486 Bacteria 1500
89 Ga0451807_1010471 3300041486 Bacteria 1694
90 Ga0451807_1039361 3300041486 Bacteria 5369
91 Ga0451843_0499749 3300041509 Bacteria 2344
92 Ga0451843_0915250 3300041509 Bacteria 1776
93 Ga0439449_0000069 3300042007 Bacteria 32108
94 Ga0450905_011653 3300042142 Bacteria 1231
95 Ga0439434_0040494 3300042435 Bacteria 1431
96 Ga0495606_0045348 3300046507 Bacteria 2914
97 Ga0495643_0080523 3300046522 Bacteria 1695
98 Ga0495663_0001412 3300046525 Bacteria 7581
99 Ga0495598_0000880 3300046537 Bacteria 5796
100 Ga0495621_0003762 3300046539 Bacteria 4205
101 Ga0495633_0032712 3300046558 Bacteria 2511
102 Ga0495671_0031761 3300046692 Bacteria 2698
103 Ga0495615_0035321 3300048090 Bacteria 1221
104 Ga0496114_0016091 3300048917 Bacteria 6020
105 Ga0496117_0002719 3300048920 Bacteria 21740
106 Ga0496118_0197597 3300048921 Bacteria 1195
107 Ga0496118_0236485 3300048921 Bacteria 1049
108 Ga0496119_0004827 3300048922 Bacteria 13209
109 Ga0496119_0104866 3300048922 Bacteria 1580
110 Ga0496120_0001136 3300048923 Bacteria 34341
111 Ga0496122_0006517 3300048925 Bacteria 13369
112 Ga0496122_0059248 3300048925 Bacteria 2827
113 Ga0496123_0000436 3300048926 Bacteria 74963
114 Ga0496123_0028018 3300048926 Bacteria 4180
115 Ga0496123_0039389 3300048926 Bacteria 3307
116 Ga0496124_0006068 3300048927 Bacteria 13293
117 Ga0496125_0088264 3300048928 Bacteria 2338
118 Ga0496126_0013974 3300048929 Bacteria 8142
119 Ga0496126_0065271 3300048929 Bacteria 3258
120 Ga0496126_0406297 3300048929 Bacteria 1103
121 Ga0501034_0051423 3300049571 Bacteria 4154
122 Ga0501239_001625 3300049672 Bacteria 1955
123 Ga0501252_042708 3300049682 Bacteria 663
124 Ga0501259_022398 3300049688 Bacteria 1135
125 Ga0501266_003586 3300049763 Bacteria 1929
126 Ga0501268_001545 3300049765 Bacteria 2890
127 Ga0501270_018373 3300049767 Bacteria 1035
128 Ga0501272_022341 3300049769 Bacteria 766
129 nmdc:mga03n38_82004_c1 3300050490 Bacteria 1517
130 nmdc:mga00v17_194442_c1 3300050491 Bacteria 1311
131 nmdc:mga00v17_275706_c1 3300050491 Bacteria 1092
132 nmdc:mga00v17_45667_c1 3300050491 Bacteria 2648
133 Ga0500634_0000051 3300053161 Bacteria 52447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_1607435 Ga0451791_1607435_24_563 178
2 3300042007 Ga0439449_0000069 Ga0439449_0000069_3703_4248 178
3 3300005347 Ga0070668_100047736 Ga0070668_1000477363 183
4 3300025972 Ga0207668_10140529 Ga0207668_101405292 183
5 3300041453 Ga0451797_1535257 Ga0451797_1535257_440_1006 183
6 3300041509 Ga0451843_0499749 Ga0451843_0499749_263_829 183
7 iso_pu_bacteria 2747842501 2748016039 187
8 3300049682 Ga0501252_042708 Ga0501252_042708_11_607 188
9 iso_pu_bacteria 2894414249 2894415450 193
10 3300031824 Ga0307413_10000718 Ga0307413_100007184 196
11 3300032004 Ga0307414_10038558 Ga0307414_100385582 196
12 3300032004 Ga0307414_10091158 Ga0307414_100911582 196
13 iso_pu_bacteria 2547132130 2547500002 196
14 iso_pu_bacteria 2547132130 2547500309 196
15 iso_pu_bacteria 2643221573 2643878491 196
16 iso_pu_bacteria 2643221720 2644659799 196
17 iso_pu_bacteria 2643221728 2644700460 196
18 iso_pu_bacteria 2747842428 2747951272 196
19 iso_pu_bacteria 2765235840 2765579759 196
20 iso_pu_bacteria 2842391507 2842392018 196
21 iso_pu_bacteria 2842757796 2842760583 196
22 iso_pu_bacteria 2919134579 2919138461 196
23 iso_pu_bacteria 2961064222 2961066087 196
24 iso_pu_bacteria 2995948881 2995952347 196
25 3300005353 Ga0070669_100040241 Ga0070669_1000402412 197
26 3300009978 Ga0105148_102160 Ga0105148_1021602 197
27 3300025923 Ga0207681_10170431 Ga0207681_101704312 197
28 3300005616 Ga0068852_100154644 Ga0068852_1001546443 198
29 3300025920 Ga0207649_10431304 Ga0207649_104313042 198
30 3300026121 Ga0207683_10109536 Ga0207683_101095363 198
31 3300037418 Ga0395900_0027260 Ga0395900_0027260_1681_2277 198
32 3300037466 Ga0395898_0349525 Ga0395898_0349525_209_805 198
33 iso_pu_bacteria 2643221579 2643908029 198
34 iso_pu_bacteria 2895498888 2895498957 198
35 3300005336 Ga0070680_100365022 Ga0070680_1003650222 199
36 3300013307 Ga0157372_10259688 Ga0157372_102596882 199
37 3300015689 Ga0183360_10001 Ga0183360_10001898 199
38 3300046537 Ga0495598_0000880 Ga0495598_0000880_4512_5111 199
39 3300046539 Ga0495621_0003762 Ga0495621_0003762_2951_3550 199
40 3300048090 Ga0495615_0035321 Ga0495615_0035321_249_848 199
41 iso_pu_bacteria 2643221581 2643915769 199
42 iso_pu_bacteria 2818991457 2819659932 199
43 iso_pu_bacteria 2852684882 2852685243 199
44 iso_pu_bacteria 2919130084 2919131368 199
45 iso_pu_bacteria 2919513703 2919516234 199
46 iso_pu_bacteria 2929195423 2929198213 199
47 iso_pu_bacteria 8002869464 8002872339 199
48 3300003320 rootH2_10056373 rootH2_100563733 200
49 3300003323 rootH1_10149252 rootH1_101492522 200
50 3300003781 Ga0055536_1005557 Ga0055536_10055573 200
51 3300005985 Ga0081539_10014367 Ga0081539_100143675 200
52 3300006186 Ga0075369_10006432 Ga0075369_100064325 200
53 3300015261 Ga0182006_1070458 Ga0182006_10704582 200
54 3300025292 Ga0209676_1000279 Ga0209676_100027998 200
55 3300025298 Ga0209050_1012881 Ga0209050_10128813 200
56 3300030732 Ga0316176_1196417 Ga0316176_11964172 200
57 3300038705 Ga0237819_15055 Ga0237819_15055_108_710 200
58 3300048922 Ga0496119_0104866 Ga0496119_0104866_407_1009 200
59 3300003316 rootH1_10025459 rootH1_100254595 201
60 3300003856 Ga0058692_1000012 Ga0058692_100001297 201
61 3300025304 Ga0209257_1025607 Ga0209257_10256073 201
62 3300027312 Ga0209371_1000007 Ga0209371_1000007293 201
63 3300030500 Ga0268256_1000008 Ga0268256_1000008657 201
64 3300031731 Ga0307405_10297080 Ga0307405_102970802 201
65 3300031824 Ga0307413_10345886 Ga0307413_103458862 201
66 3300031903 Ga0307407_10199349 Ga0307407_101993492 201
67 3300031911 Ga0307412_10100670 Ga0307412_101006702 201
68 3300032002 Ga0307416_100942718 Ga0307416_1009427182 201
69 3300032004 Ga0307414_10059198 Ga0307414_100591982 201
70 3300032004 Ga0307414_10303453 Ga0307414_103034532 201
71 3300032005 Ga0307411_10398104 Ga0307411_103981042 201
72 3300032126 Ga0307415_100356765 Ga0307415_1003567652 201
73 3300049672 Ga0501239_001625 Ga0501239_001625_674_1309 201
74 3300049688 Ga0501259_022398 Ga0501259_022398_225_833 201
75 3300049763 Ga0501266_003586 Ga0501266_003586_441_1049 201
76 3300049765 Ga0501268_001545 Ga0501268_001545_187_795 201
77 3300049767 Ga0501270_018373 Ga0501270_018373_190_798 201
78 3300049769 Ga0501272_022341 Ga0501272_022341_144_752 201
79 iso_pu_bacteria 8021626552 8021630149 201
80 3300003781 Ga0055536_1002005 Ga0055536_10020058 202
81 3300009984 Ga0105029_104002 Ga0105029_1040022 202
82 3300025292 Ga0209676_1000034 Ga0209676_1000034416 202
83 3300025304 Ga0209257_1000645 Ga0209257_100064541 202
84 3300027666 Ga0209282_1312237 Ga0209282_13122371 202
85 3300031456 Ga0307513_10039853 Ga0307513_100398535 202
86 3300032004 Ga0307414_10004643 Ga0307414_100046435 202
87 3300032004 Ga0307414_10041317 Ga0307414_100413173 202
88 3300041406 Ga0439439_0050240 Ga0439439_0050240_22_645 202
89 3300041413 Ga0439465_0048972 Ga0439465_0048972_295_915 202
90 3300041413 Ga0439465_0084559 Ga0439465_0084559_305_928 202
91 3300041460 Ga0451802_0605770 Ga0451802_0605770_595_1218 202
92 3300041486 Ga0451807_1010471 Ga0451807_1010471_709_1332 202
93 3300046522 Ga0495643_0080523 Ga0495643_0080523_982_1605 202
94 3300046525 Ga0495663_0001412 Ga0495663_0001412_1749_2372 202
95 3300046692 Ga0495671_0031761 Ga0495671_0031761_1578_2201 202
96 3300048925 Ga0496122_0059248 Ga0496122_0059248_1599_2207 202
97 3300048926 Ga0496123_0028018 Ga0496123_0028018_3494_4102 202
98 3300048926 Ga0496123_0039389 Ga0496123_0039389_2133_2756 202
99 3300048929 Ga0496126_0013974 Ga0496126_0013974_7021_7629 202
100 3300050491 nmdc:mga00v17_194442_c1 nmdc:mga00v17_194442_c1_690_1301 202
101 3300050491 nmdc:mga00v17_275706_c1 nmdc:mga00v17_275706_c1_106_717 202
102 3300050491 nmdc:mga00v17_45667_c1 nmdc:mga00v17_45667_c1_1356_1967 202
103 2162886007 SwRhRL2b_contig_2665444 SwRhRL2b_0155.00004180 203
104 2162886007 SwRhRL2b_contig_723762 SwRhRL2b_0236.00007640 203
105 3300002773 JGI25152J39213_1000035 JGI25152J39213_100003510 203
106 3300002774 JGI25150J39212_1000506 JGI25150J39212_10005068 203
107 3300003187 JGI25151J46595_10000057 JGI25151J46595_10000057134 203
108 3300003215 JGI25153J46596_10000041 JGI25153J46596_10000041141 203
109 3300003856 Ga0058692_1000006 Ga0058692_1000006234 203
110 3300006051 Ga0075364_10019062 Ga0075364_100190625 203
111 3300009148 Ga0105243_10004981 Ga0105243_100049812 203
112 3300009993 Ga0105028_106484 Ga0105028_1064842 203
113 3300025245 Ga0207425_1000044 Ga0207425_100004445 203
114 3300025258 Ga0209129_1000044 Ga0209129_1000044232 203
115 3300025294 Ga0209025_1000012 Ga0209025_1000012269 203
116 3300025297 Ga0209758_1000018 Ga0209758_1000018389 203
117 3300025935 Ga0207709_10007378 Ga0207709_100073782 203
118 3300027312 Ga0209371_1000016 Ga0209371_1000016234 203
119 3300030500 Ga0268256_1000015 Ga0268256_1000015336 203
120 3300031824 Ga0307413_10832382 Ga0307413_108323821 203
121 3300038705 Ga0237819_00013 Ga0237819_00013_17935_18546 203
122 3300041452 Ga0451793_0723539 Ga0451793_0723539_528_1139 203
123 3300041459 Ga0451800_0163290 Ga0451800_0163290_3779_4390 203
124 3300041462 Ga0451806_619891 Ga0451806_619891_2230_2841 203
125 3300041486 Ga0451807_1039361 Ga0451807_1039361_3328_3939 203
126 3300042142 Ga0450905_011653 Ga0450905_011653_260_871 203
127 3300042435 Ga0439434_0040494 Ga0439434_0040494_776_1393 203
128 3300046558 Ga0495633_0032712 Ga0495633_0032712_992_1603 203
129 3300048917 Ga0496114_0016091 Ga0496114_0016091_2714_3337 203
130 3300048921 Ga0496118_0197597 Ga0496118_0197597_442_1053 203
131 3300048929 Ga0496126_0065271 Ga0496126_0065271_186_809 203
132 3300048929 Ga0496126_0406297 Ga0496126_0406297_351_962 203
133 3300049571 Ga0501034_0051423 Ga0501034_0051423_332_943 203
134 3300050490 nmdc:mga03n38_82004_c1 nmdc:mga03n38_82004_c1_579_1190 203
135 3300053161 Ga0500634_0000051 Ga0500634_0000051_14758_15369 203
136 3300015261 Ga0182006_1035478 Ga0182006_10354782 204
137 3300015265 Ga0182005_1008185 Ga0182005_10081853 204
138 3300041451 Ga0451791_1336134 Ga0451791_1336134_637_1266 204
139 3300041453 Ga0451797_0162532 Ga0451797_0162532_1212_1841 204
140 3300041486 Ga0451807_0953828 Ga0451807_0953828_567_1196 204
141 3300041509 Ga0451843_0915250 Ga0451843_0915250_628_1257 204
142 3300046507 Ga0495606_0045348 Ga0495606_0045348_333_947 204
143 3300048928 Ga0496125_0088264 Ga0496125_0088264_1469_2083 204
144 2162886007 SwRhRL2b_contig_2636914 SwRhRL2b_0873.00000200 205
145 2162886007 SwRhRL2b_contig_3437389 SwRhRL2b_0900.00001780 205
146 3300005289 Ga0065704_10070476 Ga0065704_1007047612 205
147 3300005331 Ga0070670_100196359 Ga0070670_1001963592 205
148 3300009011 Ga0105251_10000437 Ga0105251_1000043729 205
149 3300025735 Ga0207713_1005987 Ga0207713_10059877 205
150 3300025925 Ga0207650_10011996 Ga0207650_100119962 205
151 3300048920 Ga0496117_0002719 Ga0496117_0002719_9919_10536 205
152 3300048921 Ga0496118_0236485 Ga0496118_0236485_418_1035 205
153 3300048922 Ga0496119_0004827 Ga0496119_0004827_8684_9301 205
154 3300048923 Ga0496120_0001136 Ga0496120_0001136_8789_9406 205
155 3300048925 Ga0496122_0006517 Ga0496122_0006517_3881_4498 205
156 3300048926 Ga0496123_0000436 Ga0496123_0000436_58794_59411 205
157 3300048927 Ga0496124_0006068 Ga0496124_0006068_8754_9371 205
158 iso_pu_bacteria 8021622325 8021624817 205
159 iso_pu_bacteria 8021648035 8021650123 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

34

172

0.88

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

50

171

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.9322 14 201
8gxk-assembly2.cif.gz_C pseudomonas jinjuensis n-acetyltransferase 0.9144 14 201
8gxj-assembly1.cif.gz_A pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 0.9085 14 198
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.9085 14 201
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.8953 14 198
ID Description Score Start End Superfamily
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9514 9 201 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9315 137 186 3.40.630.30
1yreD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9165 14 201 3.40.630.30
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9147 9 201 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9132 14 198 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1H3GWR8-F1-model_v4 Protein N-acetyltransferase, RimJ/RimL family 0.9807 11 205 GO:0016747
AF-A0A4Q6FJX4-F1-model_v4 deleted 0.9797 14 203
AF-A0A1H5PEQ8-F1-model_v4 Protein N-acetyltransferase, RimJ/RimL family 0.9732 14 204 GO:0016747
AF-A0A4Q6Y8J1-F1-model_v4 N-acetyltransferase 0.9714 12 204 GO:0016747
AF-A0A7W9E0R2-F1-model_v4 RimJ/RimL family protein N-acetyltransferase 0.9709 83 205 GO:0016747

Feature Viewer

pLDDT pTM Quality
94.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map