F232128

General Info

Members Datasets Scaffolds Average Seq Length
159 124 144 252

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10063715|Ga0099796_100637151
Length 284
Sequence MLRNFGSDTGNIFAVWIWKFPLTIRKDHNYMKITGNTILITGGGSGIGRGLAESFHSLGNQVIIAGRRKQALDETTSKNAGMTSLALDIEDPAAIRSFASQVTARFPKLNVLVNNAGIMRVENLQAQQGDLADAESIIATNLLGPIRLTAALLPLLQKQAHSTIMNVSSGLAFVPLAYTPTYCATKAAVHSYTQSLRFQLRSSTTEVLELIPPYVATNLLNGASDPRAMPLDAYIAEVMGILKTQPGASEICVERVKNLRFAAESGKYEDFFRTFNEAMEIDPH

Samples

Sample ID Description Type Environment
1 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
2 2643221584 Caulobacter sp. Root656 Isolate Unclassified
3 2643221734 Bosea sp. Root670 Isolate Unclassified
4 2734482264 Dyella sp. AD052 Isolate Unclassified
5 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
6 2818991467 Bosea vestrisii 3192 Isolate Unclassified
7 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
8 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
9 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
10 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
11 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
12 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
13 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
14 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
15 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
53 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
54 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
81 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
82 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
85 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
86 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
87 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
92 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
101 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
102 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
108 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
114 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
115 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
122 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 0
Isolates 9.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.75
Nodule 3.14
Rhizoplane 0.63
Rhizosphere 61.64
Stem 0
Stem Tuber 0
Unclassified 13.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1001116 3300002774 Bacteria 8082
2 JGI25151J46595_10000028 3300003187 Bacteria 208373
3 JGI25153J46596_10000044 3300003215 Bacteria 154263
4 rootH1_10123766 3300003316 Bacteria 1019
5 rootL2_10246624 3300003322 Bacteria 1116
6 rootH1_10253977 3300003323 Bacteria 1278
7 Ga0055526_1000333 3300003771 Bacteria 39007
8 Ga0055526_1000648 3300003771 Bacteria 27029
9 Ga0055526_1001015 3300003771 Bacteria 20581
10 Ga0055537_1003135 3300003773 Bacteria 5185
11 Ga0055524_1000020 3300003775 Bacteria 227971
12 Ga0055524_1007444 3300003775 Bacteria 4645
13 Ga0070658_10031889 3300005327 Bacteria 4234
14 Ga0070658_10250093 3300005327 Bacteria 1504
15 Ga0070689_100001333 3300005340 Bacteria 15704
16 Ga0070687_100025888 3300005343 Bacteria 2819
17 Ga0070688_100000192 3300005365 Bacteria 32260
18 Ga0070709_10047528 3300005434 Unclassified 2674
19 Ga0070714_100020183 3300005435 Bacteria 5438
20 Ga0070711_100047554 3300005439 Bacteria 2930
21 Ga0070665_100075311 3300005548 Bacteria 3382
22 Ga0068855_100045519 3300005563 Bacteria 5190
23 Ga0068856_100031445 3300005614 Bacteria 5193
24 Ga0068852_100495184 3300005616 Bacteria 1216
25 Ga0068864_100145778 3300005618 Bacteria 2140
26 Ga0068863_100180159 3300005841 Bacteria 2028
27 Ga0068862_100505874 3300005844 Bacteria 1147
28 Ga0070717_10154817 3300006028 Bacteria 1985
29 Ga0075365_10488727 3300006038 Bacteria 870
30 Ga0075369_10086273 3300006186 Bacteria 1397
31 Ga0099794_10061052 3300007265 Bacteria 1831
32 Ga0099795_10009218 3300007788 Bacteria 2854
33 Ga0105240_10029277 3300009093 Bacteria 7179
34 Ga0105240_10106768 3300009093 Bacteria 3395
35 Ga0105248_10003808 3300009177 Bacteria 16728
36 Ga0105237_10449553 3300009545 Bacteria 1294
37 Ga0099796_10063715 3300010159 Bacteria 1313
38 Ga0157370_10017690 3300013104 Bacteria 7186
39 Ga0157369_10005326 3300013105 Bacteria 14987
40 Ga0171462_1032 3300013250 Bacteria 98473
41 Ga0157372_10204523 3300013307 Bacteria 2288
42 Ga0163161_10622858 3300017792 Bacteria 892
43 Ga0207425_1000026 3300025245 Bacteria 301303
44 Ga0209129_1001127 3300025258 Bacteria 15522
45 Ga0209565_1000064 3300025263 Bacteria 180732
46 Ga0209673_1016473 3300025273 Bacteria 2762
47 Ga0209025_1000008 3300025294 Bacteria 1130876
48 Ga0209025_1000551 3300025294 Bacteria 69956
49 Ga0209564_1000049 3300025295 Bacteria 362075
50 Ga0209564_1000065 3300025295 Bacteria 315205
51 Ga0209564_1001989 3300025295 Bacteria 17896
52 Ga0209564_1006159 3300025295 Bacteria 6569
53 Ga0209758_1000004 3300025297 Bacteria 1375322
54 Ga0209050_1007490 3300025298 Bacteria 6107
55 Ga0209256_1000014 3300025299 Bacteria 687409
56 Ga0209256_1000200 3300025299 Bacteria 112931
57 Ga0207680_10368143 3300025903 Bacteria 1011
58 Ga0207647_10067739 3300025904 Bacteria 2162
59 Ga0207695_10022631 3300025913 Bacteria 7125
60 Ga0207695_10074092 3300025913 Bacteria 3466
61 Ga0207663_10063071 3300025916 Unclassified 2358
62 Ga0207700_10024453 3300025928 Bacteria 4180
63 Ga0207664_10161316 3300025929 Bacteria 1912
64 Ga0207670_10000241 3300025936 Bacteria 34491
65 Ga0207711_10001880 3300025941 Bacteria 19134
66 Ga0207667_10008314 3300025949 Bacteria 12345
67 Ga0207702_10042575 3300026078 Bacteria 3810
68 Ga0207698_10214955 3300026142 Bacteria 1733
69 Ga0209371_1029165 3300027312 Bacteria 1222
70 Ga0209371_1029168 3300027312 Bacteria 1222
71 Ga0268266_10359202 3300028379 Bacteria 1370
72 Ga0265318_10090362 3300028577 Bacteria 1128
73 Ga0265336_10010819 3300028666 Bacteria 3117
74 Ga0265338_10001905 3300028800 Bacteria 32594
75 Ga0265338_10009615 3300028800 Bacteria 11487
76 Ga0265338_10085199 3300028800 Bacteria 2635
77 Ga0265324_10011890 3300029957 Bacteria 3304
78 Ga0268256_1033446 3300030500 Bacteria 1214
79 Ga0268256_1034807 3300030500 Bacteria 1176
80 Ga0265330_10016454 3300031235 Bacteria 3412
81 Ga0265332_10010051 3300031238 Bacteria 4214
82 Ga0265332_10019183 3300031238 Bacteria 3019
83 Ga0265328_10013758 3300031239 Bacteria 3196
84 Ga0265320_10002053 3300031240 Bacteria 14183
85 Ga0265325_10057722 3300031241 Bacteria 1979
86 Ga0265325_10091130 3300031241 Bacteria 1503
87 Ga0265325_10145411 3300031241 Bacteria 1125
88 Ga0265329_10024984 3300031242 Bacteria 1980
89 Ga0265340_10004524 3300031247 Bacteria 7756
90 Ga0265340_10082501 3300031247 Bacteria 1512
91 Ga0265339_10005230 3300031249 Bacteria 8676
92 Ga0265339_10023284 3300031249 Bacteria 3583
93 Ga0265339_10089019 3300031249 Bacteria 1620
94 Ga0265331_10001121 3300031250 Bacteria 20536
95 Ga0265327_10109549 3300031251 Eukaryota 1322
96 Ga0265316_10003132 3300031344 Bacteria 16845
97 Ga0265316_10003728 3300031344 Bacteria 15329
98 Ga0265316_10095354 3300031344 Bacteria 2266
99 Ga0265316_10098322 3300031344 Bacteria 2227
100 Ga0265316_10305356 3300031344 Bacteria 1158
101 Ga0307513_10041595 3300031456 Bacteria 5070
102 Ga0265314_10003033 3300031711 Bacteria 16589
103 Ga0265342_10079703 3300031712 Bacteria 1893
104 Ga0307412_10007282 3300031911 Bacteria 6274
105 Ga0307414_10337658 3300032004 Bacteria 1288
106 Ga0373946_0179814 3300035171 Bacteria 1003
107 Ga0373935_0030041 3300035692 Bacteria 3366
108 Ga0373927_0005887 3300035695 Bacteria 8400
109 Ga0373947_0000142 3300035725 Bacteria 37230
110 Ga0373925_0000221 3300037068 Bacteria 60956
111 Ga0495606_0071441 3300046507 Bacteria 2185
112 Ga0495632_0168921 3300046519 Bacteria 1005
113 Ga0495643_0049484 3300046522 Bacteria 2267
114 Ga0495668_0024001 3300046616 Bacteria 3471
115 Ga0495668_0058207 3300046616 Bacteria 2133
116 Ga0495624_0123186 3300046690 Bacteria 1592
117 Ga0495670_0037048 3300046691 Bacteria 2431
118 Ga0495649_0000444 3300046694 Bacteria 35791
119 Ga0495649_0039974 3300046694 Bacteria 2570
120 Ga0495687_031443 3300047443 Bacteria 2435
121 Ga0495686_0001036 3300047472 Bacteria 33364
122 Ga0495686_0012324 3300047472 Bacteria 5985
123 Ga0496115_0000988 3300048918 Bacteria 20593
124 Ga0496116_0054215 3300048919 Bacteria 2643
125 Ga0496122_0069228 3300048925 Bacteria 2528
126 Ga0496123_0047785 3300048926 Bacteria 2886
127 Ga0496123_0097013 3300048926 Bacteria 1728
128 Ga0496125_0003591 3300048928 Bacteria 18645
129 Ga0496125_0038952 3300048928 Bacteria 4103
130 Ga0496125_0062764 3300048928 Bacteria 2968
131 Ga0496125_0077419 3300048928 Bacteria 2564
132 Ga0496126_0173808 3300048929 Bacteria 1833
133 Ga0496126_0220577 3300048929 Bacteria 1593
134 Ga0495682_0122234 3300049460 Bacteria 932
135 Ga0501034_0381162 3300049571 Bacteria 1335
136 Ga0501037_0146937 3300049573 Bacteria 1686
137 nmdc:mga00v17_159698_c1 3300050491 Bacteria 1450
138 Ga0500578_0046651 3300053086 Bacteria 2780
139 Ga0500643_005734 3300053087 Bacteria 5298
140 Ga0500655_025335 3300053133 Bacteria 1125
141 Ga0500573_0049348 3300053140 Bacteria 2422
142 Ga0500616_0000011 3300053153 Bacteria 732880
143 Ga0500616_0027636 3300053153 Bacteria 3131
144 Ga0500616_0084037 3300053153 Bacteria 1593

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10488727 Ga0075365_104887271 205
2 3300050491 nmdc:mga00v17_159698_c1 nmdc:mga00v17_159698_c1_638_1294 217
3 3300048926 Ga0496123_0097013 Ga0496123_0097013_251_1033 227
4 3300048925 Ga0496122_0069228 Ga0496122_0069228_1112_1897 230
5 3300048926 Ga0496123_0047785 Ga0496123_0047785_472_1257 230
6 3300053133 Ga0500655_025335 Ga0500655_025335_92_817 237
7 3300053153 Ga0500616_0027636 Ga0500616_0027636_1255_2004 238
8 3300046691 Ga0495670_0037048 Ga0495670_0037048_615_1448 240
9 iso_pu_bacteria 2643221552 2643781539 243
10 iso_pu_bacteria 2643221584 2643928982 243
11 iso_pu_bacteria 2643221734 2644734988 243
12 iso_pu_bacteria 2818991467 2819719541 243
13 iso_pu_bacteria 2821443989 2821449851 243
14 iso_pu_bacteria 2842482326 2842486801 243
15 iso_pu_bacteria 2917699015 2917704780 243
16 iso_pu_bacteria 2939602548 2939603263 243
17 3300003316 rootH1_10123766 rootH1_101237661 244
18 3300003322 rootL2_10246624 rootL2_102466241 244
19 3300003323 rootH1_10253977 rootH1_102539772 244
20 3300005548 Ga0070665_100075311 Ga0070665_1000753113 244
21 3300025903 Ga0207680_10368143 Ga0207680_103681431 244
22 3300025904 Ga0207647_10067739 Ga0207647_100677392 244
23 3300028379 Ga0268266_10359202 Ga0268266_103592022 244
24 3300046507 Ga0495606_0071441 Ga0495606_0071441_882_1640 244
25 3300046522 Ga0495643_0049484 Ga0495643_0049484_119_877 244
26 3300046616 Ga0495668_0058207 Ga0495668_0058207_1049_1807 244
27 3300046694 Ga0495649_0039974 Ga0495649_0039974_1304_2062 244
28 3300047443 Ga0495687_031443 Ga0495687_031443_1556_2314 244
29 iso_pu_bacteria 2734482264 2735837330 244
30 iso_pu_bacteria 2751185897 2753766632 244
31 iso_pu_bacteria 2842110456 2842112488 244
32 iso_pu_bacteria 2857516855 2857521932 244
33 iso_pu_bacteria 2936375103 2936377395 244
34 iso_pu_bacteria 8005376324 8005377762 244
35 3300005340 Ga0070689_100001333 Ga0070689_1000013338 245
36 3300005343 Ga0070687_100025888 Ga0070687_1000258883 245
37 3300005365 Ga0070688_100000192 Ga0070688_10000019211 245
38 3300005618 Ga0068864_100145778 Ga0068864_1001457783 245
39 3300005841 Ga0068863_100180159 Ga0068863_1001801592 245
40 3300005844 Ga0068862_100505874 Ga0068862_1005058742 245
41 3300025936 Ga0207670_10000241 Ga0207670_1000024122 245
42 3300031241 Ga0265325_10091130 Ga0265325_100911301 245
43 3300053087 Ga0500643_005734 Ga0500643_005734_713_1456 245
44 3300003771 Ga0055526_1000333 Ga0055526_100033320 246
45 3300005327 Ga0070658_10250093 Ga0070658_102500932 246
46 3300005434 Ga0070709_10047528 Ga0070709_100475283 246
47 3300005439 Ga0070711_100047554 Ga0070711_1000475542 246
48 3300005563 Ga0068855_100045519 Ga0068855_1000455192 246
49 3300005614 Ga0068856_100031445 Ga0068856_1000314452 246
50 3300005616 Ga0068852_100495184 Ga0068852_1004951843 246
51 3300009093 Ga0105240_10029277 Ga0105240_100292772 246
52 3300009545 Ga0105237_10449553 Ga0105237_104495531 246
53 3300013104 Ga0157370_10017690 Ga0157370_100176902 246
54 3300013105 Ga0157369_10005326 Ga0157369_100053268 246
55 3300013307 Ga0157372_10204523 Ga0157372_102045231 246
56 3300025295 Ga0209564_1000065 Ga0209564_100006582 246
57 3300025913 Ga0207695_10022631 Ga0207695_100226317 246
58 3300025916 Ga0207663_10063071 Ga0207663_100630713 246
59 3300025949 Ga0207667_10008314 Ga0207667_100083148 246
60 3300026078 Ga0207702_10042575 Ga0207702_100425755 246
61 3300026142 Ga0207698_10214955 Ga0207698_102149551 246
62 3300031241 Ga0265325_10145411 Ga0265325_101454112 246
63 3300031251 Ga0265327_10109549 Ga0265327_101095492 246
64 3300048918 Ga0496115_0000988 Ga0496115_0000988_1775_2515 246
65 3300003187 JGI25151J46595_10000028 JGI25151J46595_10000028107 247
66 3300003771 Ga0055526_1000648 Ga0055526_10006487 247
67 3300003775 Ga0055524_1000020 Ga0055524_1000020186 247
68 3300003775 Ga0055524_1007444 Ga0055524_10074441 247
69 3300005327 Ga0070658_10031889 Ga0070658_100318895 247
70 3300005435 Ga0070714_100020183 Ga0070714_1000201833 247
71 3300006028 Ga0070717_10154817 Ga0070717_101548172 247
72 3300006186 Ga0075369_10086273 Ga0075369_100862731 247
73 3300007265 Ga0099794_10061052 Ga0099794_100610522 247
74 3300007788 Ga0099795_10009218 Ga0099795_100092184 247
75 3300009093 Ga0105240_10106768 Ga0105240_101067682 247
76 3300010159 Ga0099796_10063715 Ga0099796_100637151 247
77 3300013250 Ga0171462_1032 Ga0171462_103219 247
78 3300025294 Ga0209025_1000008 Ga0209025_1000008804 247
79 3300025295 Ga0209564_1000049 Ga0209564_1000049310 247
80 3300025299 Ga0209256_1000014 Ga0209256_1000014329 247
81 3300025299 Ga0209256_1000200 Ga0209256_100020020 247
82 3300025913 Ga0207695_10074092 Ga0207695_100740923 247
83 3300025929 Ga0207664_10161316 Ga0207664_101613163 247
84 3300027312 Ga0209371_1029165 Ga0209371_10291652 247
85 3300027312 Ga0209371_1029168 Ga0209371_10291682 247
86 3300028577 Ga0265318_10090362 Ga0265318_100903622 247
87 3300028666 Ga0265336_10010819 Ga0265336_100108192 247
88 3300028800 Ga0265338_10001905 Ga0265338_1000190512 247
89 3300028800 Ga0265338_10009615 Ga0265338_100096154 247
90 3300028800 Ga0265338_10085199 Ga0265338_100851992 247
91 3300029957 Ga0265324_10011890 Ga0265324_100118902 247
92 3300030500 Ga0268256_1033446 Ga0268256_10334462 247
93 3300030500 Ga0268256_1034807 Ga0268256_10348072 247
94 3300031235 Ga0265330_10016454 Ga0265330_100164542 247
95 3300031238 Ga0265332_10010051 Ga0265332_100100513 247
96 3300031238 Ga0265332_10019183 Ga0265332_100191833 247
97 3300031239 Ga0265328_10013758 Ga0265328_100137582 247
98 3300031240 Ga0265320_10002053 Ga0265320_100020537 247
99 3300031241 Ga0265325_10057722 Ga0265325_100577221 247
100 3300031242 Ga0265329_10024984 Ga0265329_100249841 247
101 3300031247 Ga0265340_10004524 Ga0265340_100045247 247
102 3300031247 Ga0265340_10082501 Ga0265340_100825012 247
103 3300031249 Ga0265339_10005230 Ga0265339_100052306 247
104 3300031249 Ga0265339_10023284 Ga0265339_100232844 247
105 3300031249 Ga0265339_10089019 Ga0265339_100890192 247
106 3300031250 Ga0265331_10001121 Ga0265331_1000112119 247
107 3300031344 Ga0265316_10003132 Ga0265316_100031329 247
108 3300031344 Ga0265316_10003728 Ga0265316_100037286 247
109 3300031344 Ga0265316_10095354 Ga0265316_100953542 247
110 3300031344 Ga0265316_10098322 Ga0265316_100983222 247
111 3300031344 Ga0265316_10305356 Ga0265316_103053561 247
112 3300031456 Ga0307513_10041595 Ga0307513_100415952 247
113 3300031711 Ga0265314_10003033 Ga0265314_1000303311 247
114 3300031712 Ga0265342_10079703 Ga0265342_100797031 247
115 3300032004 Ga0307414_10337658 Ga0307414_103376581 247
116 3300035171 Ga0373946_0179814 Ga0373946_0179814_149_916 247
117 3300035692 Ga0373935_0030041 Ga0373935_0030041_706_1473 247
118 3300035695 Ga0373927_0005887 Ga0373927_0005887_3779_4546 247
119 3300035725 Ga0373947_0000142 Ga0373947_0000142_31163_31930 247
120 3300037068 Ga0373925_0000221 Ga0373925_0000221_54892_55659 247
121 3300046519 Ga0495632_0168921 Ga0495632_0168921_107_862 247
122 3300046616 Ga0495668_0024001 Ga0495668_0024001_1438_2190 247
123 3300046690 Ga0495624_0123186 Ga0495624_0123186_675_1442 247
124 3300047472 Ga0495686_0001036 Ga0495686_0001036_8405_9160 247
125 3300048928 Ga0496125_0003591 Ga0496125_0003591_15557_16312 247
126 3300048928 Ga0496125_0062764 Ga0496125_0062764_1475_2230 247
127 3300048928 Ga0496125_0077419 Ga0496125_0077419_530_1285 247
128 3300048929 Ga0496126_0173808 Ga0496126_0173808_836_1591 247
129 3300048929 Ga0496126_0220577 Ga0496126_0220577_59_814 247
130 3300049460 Ga0495682_0122234 Ga0495682_0122234_27_797 247
131 3300049571 Ga0501034_0381162 Ga0501034_0381162_535_1290 247
132 3300049573 Ga0501037_0146937 Ga0501037_0146937_439_1194 247
133 3300053086 Ga0500578_0046651 Ga0500578_0046651_998_1753 247
134 3300053153 Ga0500616_0084037 Ga0500616_0084037_170_925 247
135 3300009177 Ga0105248_10003808 Ga0105248_1000380820 248
136 3300025928 Ga0207700_10024453 Ga0207700_100244533 248
137 3300025941 Ga0207711_10001880 Ga0207711_100018804 248
138 3300031911 Ga0307412_10007282 Ga0307412_100072823 248
139 3300046694 Ga0495649_0000444 Ga0495649_0000444_3436_4185 248
140 3300047472 Ga0495686_0012324 Ga0495686_0012324_3972_4739 248
141 3300048919 Ga0496116_0054215 Ga0496116_0054215_1719_2498 248
142 3300048928 Ga0496125_0038952 Ga0496125_0038952_2861_3640 248
143 3300053153 Ga0500616_0000011 Ga0500616_0000011_196362_197123 248
144 iso_pu_bacteria 2933586486 2933588623 248
145 3300002774 JGI25150J39212_1001116 JGI25150J39212_10011165 249
146 3300003215 JGI25153J46596_10000044 JGI25153J46596_10000044134 249
147 3300003771 Ga0055526_1001015 Ga0055526_100101515 249
148 3300003773 Ga0055537_1003135 Ga0055537_10031356 249
149 3300017792 Ga0163161_10622858 Ga0163161_106228581 249
150 3300025245 Ga0207425_1000026 Ga0207425_1000026229 249
151 3300025258 Ga0209129_1001127 Ga0209129_10011278 249
152 3300025263 Ga0209565_1000064 Ga0209565_100006436 249
153 3300025273 Ga0209673_1016473 Ga0209673_10164733 249
154 3300025294 Ga0209025_1000551 Ga0209025_100055119 249
155 3300025295 Ga0209564_1001989 Ga0209564_10019892 249
156 3300025295 Ga0209564_1006159 Ga0209564_10061597 249
157 3300025297 Ga0209758_1000004 Ga0209758_10000041171 249
158 3300025298 Ga0209050_1007490 Ga0209050_10074906 249
159 3300053140 Ga0500573_0049348 Ga0500573_0049348_678_1427 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

228

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

246

0.9

PF08659

KR

KR domain

36

208

0.86

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

38

208

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cql-assembly4.cif.gz_J crystal structure of heterotetrameric human ketoacyl reductase complexed with nad 0.9446 6 185
3emk-assembly1.cif.gz_C 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9431 2 183
2d1y-assembly1.cif.gz_B crystal structure of tt0321 from thermus thermophilus hb8 0.9388 4 188
3emk-assembly1.cif.gz_B 2.5a crystal structure of glucose/ribitol dehydrogenase from brucella melitensis 0.9375 2 183
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.9329 6 182
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 6 179 3.40.50.720
af_A0A368UI72_22_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9288 6 72 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9283 6 182 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9241 2 182 3.40.50.720
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9194 6 88 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q3WWV3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9877 1 185 GO:0016491
AF-A0A645FRN2-F1-model_v4 Oxidoreductase 0.9833 52 245 GO:0016020
GO:0016491
AF-A0A8B3MMC2-F1-model_v4 deleted 0.9829 1 245
AF-A0A4Q3WWV3-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9824 1 185 GO:0016491
AF-A0A059DS82-F1-model_v4 DltE 0.9822 1 249 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
95.11 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map