F232032

General Info

Members Datasets Scaffolds Average Seq Length
159 110 318 207

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10415705|Ga0111539_104157052
Length 221
Sequence MAETAQLSAKPRSELGSRANKRLRDAGFVPGVIYGHKEAVVPVTLPKKEVVTYLDRGTFLFDLAVDGKSEKVLVKEVQYDHLGQEVLHVDFARVSLDEKVEITVPLELKGTPKGEAEGAVLQQIVAELEIECAVTDIPKEIVHNVADMEKDSELRVRDLKLPPGVRALQDEDLILAMVKEIEEAAPAEAAVEEGAAEPEVIGRKPEDEEGAAAEGGEAEKK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
89 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.37
Stem 0
Stem Tuber 0
Unclassified 16.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10415705 3300009094 Bacteria 1566
2 Ga0070676_10207435 3300005328 Bacteria 1288
3 Ga0070690_100141015 3300005330 Bacteria 1636
4 Ga0070670_100081734 3300005331 Bacteria 2776
5 Ga0070670_100121108 3300005331 Bacteria 2257
6 Ga0070677_10052874 3300005333 Bacteria 1649
7 Ga0070682_100347173 3300005337 Bacteria 1105
8 Ga0070660_100657310 3300005339 Bacteria 878
9 Ga0070661_100070419 3300005344 Unclassified 2572
10 Ga0070675_100104879 3300005354 Bacteria 2385
11 Ga0070675_100165803 3300005354 Bacteria 1902
12 Ga0070671_100134889 3300005355 Bacteria 2081
13 Ga0070671_100449308 3300005355 Bacteria 1106
14 Ga0070674_100045826 3300005356 Bacteria 2988
15 Ga0070673_100208671 3300005364 Bacteria 1686
16 Ga0070667_100007302 3300005367 Bacteria 9189
17 Ga0070708_100542300 3300005445 Unclassified 1097
18 Ga0070684_101009724 3300005535 Bacteria 781
19 Ga0070665_100001162 3300005548 Bacteria 32364
20 Ga0070665_100208701 3300005548 Bacteria 1954
21 Ga0070665_100364238 3300005548 Bacteria 1452
22 Ga0068855_100100083 3300005563 Bacteria 3338
23 Ga0068855_100109374 3300005563 Bacteria 3174
24 Ga0070664_100042840 3300005564 Bacteria 3820
25 Ga0068856_100193107 3300005614 Bacteria 2050
26 Ga0068859_100473336 3300005617 Unclassified 1348
27 Ga0068863_100080320 3300005841 Bacteria 3089
28 Ga0068863_100416418 3300005841 Unclassified 1316
29 Ga0068860_100160558 3300005843 Unclassified 2167
30 Ga0068860_100188801 3300005843 Bacteria 1994
31 Ga0081539_10009883 3300005985 Bacteria 7868
32 Ga0075430_100204368 3300006846 Bacteria 1640
33 Ga0075431_100034395 3300006847 Bacteria 5220
34 Ga0075429_100127824 3300006880 Bacteria 2223
35 Ga0097620_100473310 3300006931 Unclassified 1348
36 Ga0105240_10063091 3300009093 Bacteria 4611
37 Ga0105240_10757563 3300009093 Bacteria 1055
38 Ga0105245_10074027 3300009098 Bacteria 3098
39 Ga0105247_10317182 3300009101 Bacteria 1086
40 Ga0105241_10058004 3300009174 Bacteria 2972
41 Ga0105241_10241656 3300009174 Unclassified 1527
42 Ga0105242_11189338 3300009176 Bacteria 781
43 Ga0105248_10477287 3300009177 Bacteria 1406
44 Ga0105248_10503023 3300009177 Unclassified 1366
45 Ga0105238_10073565 3300009551 Bacteria 3412
46 Ga0105239_10045440 3300010375 Bacteria 4813
47 Ga0105239_10464230 3300010375 Bacteria 1437
48 Ga0105239_11161243 3300010375 Unclassified 889
49 Ga0157371_10188608 3300013102 Bacteria 1476
50 Ga0157371_10406515 3300013102 Unclassified 997
51 Ga0157370_10137218 3300013104 Bacteria 2279
52 Ga0157370_10585276 3300013104 Bacteria 1022
53 Ga0157369_10049204 3300013105 Bacteria 4570
54 Ga0157369_10094165 3300013105 Bacteria 3197
55 Ga0157369_10528331 3300013105 Unclassified 1220
56 Ga0157374_10187295 3300013296 Bacteria 2023
57 Ga0157374_10318173 3300013296 Bacteria 1542
58 Ga0157378_10273574 3300013297 Bacteria 1625
59 Ga0163162_10148665 3300013306 Bacteria 2460
60 Ga0157372_10065241 3300013307 Bacteria 4087
61 Ga0157372_10088199 3300013307 Bacteria 3522
62 Ga0157372_10215321 3300013307 Bacteria 2226
63 Ga0157372_10260931 3300013307 Bacteria 2012
64 Ga0157372_10536712 3300013307 Bacteria 1364
65 Ga0157372_10646289 3300013307 Unclassified 1232
66 Ga0157372_10679007 3300013307 Unclassified 1199
67 Ga0157372_10722948 3300013307 Bacteria 1158
68 Ga0163163_10973583 3300014325 Unclassified 912
69 Ga0157377_10567178 3300014745 Unclassified 804
70 Ga0206349_1512689 3300020075 Bacteria 872
71 Ga0206352_11036042 3300020078 Bacteria 2073
72 Ga0207682_10197932 3300025893 Bacteria 923
73 Ga0207645_10203715 3300025907 Bacteria 1302
74 Ga0207705_10733644 3300025909 Bacteria 768
75 Ga0207654_10110380 3300025911 Unclassified 1710
76 Ga0207695_10000211 3300025913 Bacteria 156467
77 Ga0207649_10033245 3300025920 Bacteria 3080
78 Ga0207650_10093813 3300025925 Bacteria 2298
79 Ga0207650_10166448 3300025925 Bacteria 1750
80 Ga0207650_10955356 3300025925 Bacteria 728
81 Ga0207659_10302250 3300025926 Bacteria 1314
82 Ga0207659_10329224 3300025926 Bacteria 1262
83 Ga0207687_10164209 3300025927 Bacteria 1707
84 Ga0207700_10025570 3300025928 Bacteria 4102
85 Ga0207644_10043617 3300025931 Bacteria 3184
86 Ga0207644_10293057 3300025931 Unclassified 1309
87 Ga0207706_10916309 3300025933 Bacteria 740
88 Ga0207691_10011591 3300025940 Bacteria 8465
89 Ga0207691_10392331 3300025940 Bacteria 1184
90 Ga0207711_10441016 3300025941 Bacteria 1212
91 Ga0207711_10909418 3300025941 Bacteria 818
92 Ga0207661_10135963 3300025944 Bacteria 2111
93 Ga0207661_10231218 3300025944 Bacteria 1637
94 Ga0207679_10044108 3300025945 Bacteria 3216
95 Ga0207667_10138426 3300025949 Bacteria 2506
96 Ga0207651_10150659 3300025960 Bacteria 1810
97 Ga0207668_10462478 3300025972 Bacteria 1085
98 Ga0207658_10011176 3300025986 Bacteria 6115
99 Ga0207658_10748246 3300025986 Unclassified 885
100 Ga0207702_10560422 3300026078 Bacteria 1118
101 Ga0207702_10769544 3300026078 Bacteria 951
102 Ga0207641_10200826 3300026088 Unclassified 1838
103 Ga0207674_10000651 3300026116 Bacteria 45182
104 Ga0207675_100614378 3300026118 Bacteria 1091
105 Ga0207683_10256748 3300026121 Bacteria 1595
106 Ga0268266_10000395 3300028379 Bacteria 66128
107 Ga0268266_10154810 3300028379 Bacteria 2069
108 Ga0268264_10038790 3300028381 Bacteria 3933
109 Ga0268264_10490847 3300028381 Bacteria 1196
110 Ga0307405_10741664 3300031731 Bacteria 817
111 Ga0307410_10008691 3300031852 Bacteria 5648
112 Ga0307410_10419638 3300031852 Unclassified 1085
113 Ga0307409_100053355 3300031995 Bacteria 3106
114 Ga0307409_100105229 3300031995 Bacteria 2352
115 Ga0307409_101372196 3300031995 Bacteria 733
116 Ga0307416_100211483 3300032002 Bacteria 1851
117 Ga0307416_100797361 3300032002 Bacteria 1040
118 Ga0307414_10616469 3300032004 Bacteria 975
119 Ga0307415_100303333 3300032126 Bacteria 1324
120 Ga0307415_100773587 3300032126 Bacteria 874
121 Ga0373937_0032077 3300036401 Bacteria 4763
122 Ga0373937_0765477 3300036401 Bacteria 913
123 Ga0395899_0186422 3300037312 Bacteria 1454
124 Ga0395900_0170913 3300037418 Bacteria 2213
125 Ga0395900_0278369 3300037418 Bacteria 1666
126 Ga0395898_0202972 3300037466 Bacteria 1892
127 Ga0395905_0356290 3300037471 Unclassified 1356
128 Ga0395901_0016587 3300038443 Bacteria 7506
129 Ga0395901_0412589 3300038443 Bacteria 1386
130 Ga0436365_0491476 3300039437 Bacteria 1205
131 Ga0466972_0100899 3300044658 Bacteria 1366
132 Ga0495639_0067150 3300046475 Bacteria 1652
133 Ga0495662_0144661 3300046476 Unclassified 1171
134 Ga0495630_0001667 3300046517 Bacteria 15452
135 Ga0495652_0200277 3300046529 Unclassified 1516
136 Ga0495665_0017696 3300046531 Bacteria 3832
137 Ga0495667_0031683 3300046559 Bacteria 3547
138 Ga0495667_0434366 3300046559 Unclassified 826
139 Ga0495646_0349432 3300046680 Bacteria 775
140 Ga0495624_0041265 3300046690 Bacteria 2952
141 Ga0495581_0114506 3300047315 Bacteria 1568
142 Ga0495684_0004765 3300047471 Bacteria 10602
143 Ga0495684_0032813 3300047471 Bacteria 3989
144 Ga0495684_0198542 3300047471 Bacteria 1480
145 Ga0501034_0000836 3300049571 Bacteria 45672
146 Ga0501034_0015636 3300049571 Bacteria 7795
147 Ga0501037_0075545 3300049573 Bacteria 2447
148 Ga0501040_0181780 3300049576 Bacteria 1491
149 Ga0501047_0072281 3300049581 Bacteria 3320
150 Ga0501047_0578599 3300049581 Unclassified 946
151 Ga0501070_0084311 3300049586 Bacteria 2631
152 Ga0501080_0002086 3300049742 Bacteria 17356
153 Ga0501083_0039040 3300049744 Unclassified 3225
154 Ga0501035_0611524 3300049822 Bacteria 887
155 Ga0501044_0010913 3300049823 Bacteria 9861
156 nmdc:mga09592_64001_c1 3300050508 Bacteria 3113
157 nmdc:mga0qj67_227240_c1 3300050509 Bacteria 1515
158 nmdc:mga06r32_447358_c1 3300050510 Unclassified 1272
159 Ga0501082_0691879 3300060353 Bacteria 892
160 Ga0111539_10415705
161 Ga0070676_10207435
162 Ga0070690_100141015
163 Ga0070670_100081734
164 Ga0070670_100121108
165 Ga0070677_10052874
166 Ga0070682_100347173
167 Ga0070660_100657310
168 Ga0070661_100070419
169 Ga0070675_100104879
170 Ga0070675_100165803
171 Ga0070671_100134889
172 Ga0070671_100449308
173 Ga0070674_100045826
174 Ga0070673_100208671
175 Ga0070667_100007302
176 Ga0070708_100542300
177 Ga0070684_101009724
178 Ga0070665_100001162
179 Ga0070665_100208701
180 Ga0070665_100364238
181 Ga0068855_100100083
182 Ga0068855_100109374
183 Ga0070664_100042840
184 Ga0068856_100193107
185 Ga0068859_100473336
186 Ga0068863_100080320
187 Ga0068863_100416418
188 Ga0068860_100160558
189 Ga0068860_100188801
190 Ga0081539_10009883
191 Ga0075430_100204368
192 Ga0075431_100034395
193 Ga0075429_100127824
194 Ga0097620_100473310
195 Ga0105240_10063091
196 Ga0105240_10757563
197 Ga0105245_10074027
198 Ga0105247_10317182
199 Ga0105241_10058004
200 Ga0105241_10241656
201 Ga0105242_11189338
202 Ga0105248_10477287
203 Ga0105248_10503023
204 Ga0105238_10073565
205 Ga0105239_10045440
206 Ga0105239_10464230
207 Ga0105239_11161243
208 Ga0157371_10188608
209 Ga0157371_10406515
210 Ga0157370_10137218
211 Ga0157370_10585276
212 Ga0157369_10049204
213 Ga0157369_10094165
214 Ga0157369_10528331
215 Ga0157374_10187295
216 Ga0157374_10318173
217 Ga0157378_10273574
218 Ga0163162_10148665
219 Ga0157372_10065241
220 Ga0157372_10088199
221 Ga0157372_10215321
222 Ga0157372_10260931
223 Ga0157372_10536712
224 Ga0157372_10646289
225 Ga0157372_10679007
226 Ga0157372_10722948
227 Ga0163163_10973583
228 Ga0157377_10567178
229 Ga0206349_1512689
230 Ga0206352_11036042
231 Ga0207682_10197932
232 Ga0207645_10203715
233 Ga0207705_10733644
234 Ga0207654_10110380
235 Ga0207695_10000211
236 Ga0207649_10033245
237 Ga0207650_10093813
238 Ga0207650_10166448
239 Ga0207650_10955356
240 Ga0207659_10302250
241 Ga0207659_10329224
242 Ga0207687_10164209
243 Ga0207700_10025570
244 Ga0207644_10043617
245 Ga0207644_10293057
246 Ga0207706_10916309
247 Ga0207691_10011591
248 Ga0207691_10392331
249 Ga0207711_10441016
250 Ga0207711_10909418
251 Ga0207661_10135963
252 Ga0207661_10231218
253 Ga0207679_10044108
254 Ga0207667_10138426
255 Ga0207651_10150659
256 Ga0207668_10462478
257 Ga0207658_10011176
258 Ga0207658_10748246
259 Ga0207702_10560422
260 Ga0207702_10769544
261 Ga0207641_10200826
262 Ga0207674_10000651
263 Ga0207675_100614378
264 Ga0207683_10256748
265 Ga0268266_10000395
266 Ga0268266_10154810
267 Ga0268264_10038790
268 Ga0268264_10490847
269 Ga0307405_10741664
270 Ga0307410_10008691
271 Ga0307410_10419638
272 Ga0307409_100053355
273 Ga0307409_100105229
274 Ga0307409_101372196
275 Ga0307416_100211483
276 Ga0307416_100797361
277 Ga0307414_10616469
278 Ga0307415_100303333
279 Ga0307415_100773587
280 Ga0373937_0032077
281 Ga0373937_0765477
282 Ga0395899_0186422
283 Ga0395900_0170913
284 Ga0395900_0278369
285 Ga0395898_0202972
286 Ga0395905_0356290
287 Ga0395901_0016587
288 Ga0395901_0412589
289 Ga0436365_0491476
290 Ga0466972_0100899
291 Ga0495639_0067150
292 Ga0495662_0144661
293 Ga0495630_0001667
294 Ga0495652_0200277
295 Ga0495665_0017696
296 Ga0495667_0031683
297 Ga0495667_0434366
298 Ga0495646_0349432
299 Ga0495624_0041265
300 Ga0495581_0114506
301 Ga0495684_0004765
302 Ga0495684_0032813
303 Ga0495684_0198542
304 Ga0501034_0000836
305 Ga0501034_0015636
306 Ga0501037_0075545
307 Ga0501040_0181780
308 Ga0501047_0072281
309 Ga0501047_0578599
310 Ga0501070_0084311
311 Ga0501080_0002086
312 Ga0501083_0039040
313 Ga0501035_0611524
314 Ga0501044_0010913
315 nmdc:mga09592_64001_c1
316 nmdc:mga0qj67_227240_c1
317 nmdc:mga06r32_447358_c1
318 Ga0501082_0691879

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01386

Ribosomal_L25p

Ribosomal L25p family

7

91

0.97

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

99

182

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fr8-assembly1.cif.gz_2 structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.939 1 180
6dnc-assembly1.cif.gz_Z e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon 0.932 6 95
8fr8-assembly1.cif.gz_2 structure of mycobacterium smegmatis rsh bound to a 70s translation initiation complex 0.9289 1 180
6ogg-assembly1.cif.gz_v 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). 0.9263 6 95
5xym-assembly1.cif.gz_V large subunit of mycobacterium smegmatis 0.9231 5 183
ID Description Score Start End Superfamily
af_P9WHB5_101_189_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9638 99 181 2.170.120.20
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9598 96 176 2.170.120.20
af_K7MM89_88_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9436 99 182 2.170.120.20
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9375 96 176 2.170.120.20
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.9346 5 95 2.40.240.10
ID Description Score Start End GO Terms
AF-A0A655FIU8-F1-model_v4 50S ribosomal protein L25 0.9595 62 181 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-C0W0Z7-F1-model_v4 Ribosomal L25p family protein 0.9591 3 96 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A4Q2XX94-F1-model_v4 50S ribosomal protein L25 0.9554 4 96 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2A5DJ97-F1-model_v4 Large ribosomal subunit protein bL25 L25 domain-containing protein 0.9536 4 95 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A6L6D034-F1-model_v4 50S ribosomal protein L25 0.9525 4 96 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map