F231919

General Info

Members Datasets Scaffolds Average Seq Length
159 111 318 300

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100041735|Ga0075430_1000417353
Length 326
Sequence VRSPGKGTFVQETRSDPSTTPTPTHTTRYDVIIVGAGPAGLSAALMLGRCSRSVLICDTGRPRNAASHAMHGYLSRDGVPPLEFLAMGRKELERYDTVSLRQVEVVEASCAPDKRFDVTLATGENIRSRKLLIATGVVDNLPTIEGFRELYGRSVFHCPYCDGWEVRDQPLAIYGRGERGLGLSLELTAWSRDLVLCTDGDADIDRDGYDRLARNGIIVREERIARLEGTEGRLDHVVFATGERLPRRALFFTTGQFQRSDLSTRLGCEINEKGTVRTGKYETTHLPGLYVAGDASRAVQWVVVAAAEGAEAAFAINSDLIKEDLQ

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
55 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
56 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
68 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
69 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
70 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
71 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
72 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
77 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
89 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
90 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
91 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
92 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
93 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
94 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
97 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
105 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
106 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
107 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
108 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
110 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.58
Nodule 0
Rhizoplane 3.14
Rhizosphere 83.02
Stem 0
Stem Tuber 0
Unclassified 10.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100041735 3300006846 Bacteria 3881
2 JGI24743J22301_10016063 3300001991 Bacteria 1393
3 JGI24751J29686_10026170 3300002459 Unclassified 1210
4 Ga0065712_10092955 3300005290 Bacteria 2311
5 Ga0070683_100000018 3300005329 Bacteria 193063
6 Ga0070683_100101800 3300005329 Bacteria 2705
7 Ga0070670_100022139 3300005331 Bacteria 5470
8 Ga0070670_100069292 3300005331 Bacteria 3028
9 Ga0068868_100145623 3300005338 Unclassified 1948
10 Ga0070675_100104472 3300005354 Bacteria 2390
11 Ga0070674_100001507 3300005356 Bacteria 12416
12 Ga0070659_100157964 3300005366 Bacteria 1853
13 Ga0070667_100200613 3300005367 Bacteria 1770
14 Ga0070663_100243977 3300005455 Bacteria 1419
15 Ga0070678_100041180 3300005456 Bacteria 3273
16 Ga0070685_10266494 3300005466 Bacteria 1141
17 Ga0070684_100000011 3300005535 Bacteria 170628
18 Ga0070672_100197276 3300005543 Bacteria 1682
19 Ga0070695_100157545 3300005545 Bacteria 1591
20 Ga0068855_100112592 3300005563 Bacteria 3123
21 Ga0070664_100072658 3300005564 Bacteria 2951
22 Ga0070664_100192779 3300005564 Bacteria 1816
23 Ga0068857_100112723 3300005577 Bacteria 2445
24 Ga0068852_100176524 3300005616 Bacteria 2006
25 Ga0068859_100182608 3300005617 Bacteria 2181
26 Ga0081455_10114328 3300005937 Bacteria 2139
27 Ga0075365_10000761 3300006038 Bacteria 13103
28 Ga0075365_10049475 3300006038 Bacteria 2770
29 Ga0075368_10006192 3300006042 Bacteria 4167
30 Ga0075368_10106995 3300006042 Bacteria 1151
31 Ga0075364_10007455 3300006051 Bacteria 6498
32 Ga0075364_10031472 3300006051 Bacteria 3409
33 Ga0075364_10039751 3300006051 Bacteria 3050
34 Ga0075367_10054319 3300006178 Bacteria 2375
35 Ga0075366_10005945 3300006195 Bacteria 6640
36 Ga0075366_10007165 3300006195 Bacteria 6141
37 Ga0075366_10090176 3300006195 Bacteria 1836
38 Ga0075428_100016720 3300006844 Bacteria 8099
39 Ga0075430_100000745 3300006846 Bacteria 25013
40 Ga0075430_100007978 3300006846 Bacteria 8948
41 Ga0075431_100005754 3300006847 Bacteria 12255
42 Ga0075431_100011956 3300006847 Bacteria 8757
43 Ga0075431_100058832 3300006847 Bacteria 3966
44 Ga0075431_100072871 3300006847 Archaea 3544
45 Ga0075431_100084222 3300006847 Bacteria 3282
46 Ga0075431_100101293 3300006847 Bacteria 2972
47 Ga0075431_100715732 3300006847 Bacteria 978
48 Ga0075433_10034347 3300006852 Bacteria 4355
49 Ga0075433_10047951 3300006852 Bacteria 3715
50 Ga0075433_10116169 3300006852 Bacteria 2374
51 Ga0075433_10128384 3300006852 Bacteria 2252
52 Ga0097620_100182601 3300006931 Bacteria 2181
53 Ga0111539_10114999 3300009094 Bacteria 3155
54 Ga0111539_10223636 3300009094 Bacteria 2192
55 Ga0105245_10226223 3300009098 Unclassified 1807
56 Ga0114129_10048789 3300009147 Bacteria 5951
57 Ga0114129_10276243 3300009147 Unclassified 2246
58 Ga0114129_10580505 3300009147 Bacteria 1455
59 Ga0157370_10097690 3300013104 Bacteria 2755
60 Ga0157370_10122124 3300013104 Bacteria 2432
61 Ga0157369_10023088 3300013105 Bacteria 6931
62 Ga0157369_10335133 3300013105 Bacteria 1572
63 Ga0163162_10032205 3300013306 Bacteria 5205
64 Ga0207697_10001095 3300025315 Bacteria 14934
65 Ga0207707_10194192 3300025912 Unclassified 1771
66 Ga0207650_10005118 3300025925 Bacteria 8947
67 Ga0207659_10134640 3300025926 Unclassified 1911
68 Ga0207690_10189457 3300025932 Unclassified 1555
69 Ga0207691_10254908 3300025940 Bacteria 1513
70 Ga0207661_10000025 3300025944 Bacteria 195900
71 Ga0207679_10179185 3300025945 Unclassified 1752
72 Ga0207667_10092410 3300025949 Bacteria 3125
73 Ga0207658_10091923 3300025986 Bacteria 2356
74 Ga0207677_10118567 3300026023 Unclassified 1986
75 Ga0207678_10052591 3300026067 Bacteria 3512
76 Ga0207674_10065829 3300026116 Bacteria 3652
77 Ga0207683_10078595 3300026121 Bacteria 2924
78 Ga0207698_10094608 3300026142 Bacteria 2457
79 Ga0209813_10053021 3300027866 Bacteria 1274
80 Ga0307413_10143119 3300031824 Bacteria 1655
81 Ga0307412_10095004 3300031911 Bacteria 2095
82 Ga0307409_100407170 3300031995 Bacteria 1301
83 Ga0307416_100041048 3300032002 Bacteria 3601
84 Ga0307416_100121174 3300032002 Bacteria 2331
85 Ga0307416_100205060 3300032002 Bacteria 1875
86 Ga0307414_10345586 3300032004 Bacteria 1275
87 Ga0373937_0148571 3300036401 Bacteria 2195
88 Ga0373937_0523502 3300036401 Bacteria 1127
89 Ga0373925_0600172 3300037068 Unclassified 907
90 Ga0395900_0050971 3300037418 Bacteria 4263
91 Ga0395905_0014789 3300037471 Bacteria 7442
92 Ga0395901_0305195 3300038443 Unclassified 1650
93 Ga0436365_1850237 3300039437 Unclassified 2049
94 Ga0436363_0942573 3300039450 Bacteria 3682
95 Ga0439453_0024863 3300041408 Bacteria 1102
96 Ga0439431_0021974 3300041997 Bacteria 1535
97 Ga0439433_0004793 3300041999 Bacteria 2907
98 Ga0450923_009726 3300042125 Bacteria 1690
99 Ga0439460_0042608 3300042461 Unclassified 1338
100 Ga0495684_0363597 3300047471 Bacteria 1024
101 Ga0496102_0030716 3300048905 Bacteria 4810
102 Ga0496103_0052094 3300048906 Bacteria 2535
103 Ga0496108_0053691 3300048911 Bacteria 3380
104 Ga0496112_0081659 3300048915 Bacteria 3197
105 Ga0496113_0208297 3300048916 Bacteria 1556
106 Ga0501031_0063025 3300049568 Bacteria 2416
107 Ga0501032_0214025 3300049569 Bacteria 1256
108 Ga0501034_0019838 3300049571 Bacteria 6869
109 Ga0501034_0069782 3300049571 Bacteria 3525
110 Ga0501036_0142143 3300049572 Bacteria 2025
111 Ga0501039_0012170 3300049575 Bacteria 6560
112 Ga0501040_0042847 3300049576 Bacteria 3084
113 Ga0501046_0299089 3300049580 Bacteria 1176
114 Ga0501046_0302792 3300049580 Bacteria 1167
115 Ga0501047_0103610 3300049581 Bacteria 2726
116 Ga0501069_0262982 3300049585 Bacteria 1008
117 Ga0501071_0321922 3300049587 Bacteria 1174
118 Ga0501072_0178823 3300049588 Bacteria 1692
119 Ga0501074_0024472 3300049590 Bacteria 4389
120 Ga0501075_0021399 3300049591 Bacteria 4714
121 Ga0501075_0029464 3300049591 Bacteria 4060
122 Ga0501075_0040959 3300049591 Bacteria 3471
123 Ga0501076_0028452 3300049592 Bacteria 4340
124 Ga0501076_0068576 3300049592 Bacteria 2833
125 Ga0501079_0269863 3300049741 Bacteria 1330
126 Ga0501080_0276452 3300049742 Bacteria 1527
127 Ga0501081_0078021 3300049743 Bacteria 2315
128 Ga0501045_0031937 3300049824 Bacteria 3814
129 nmdc:mga03683_122198_c1 3300050489 Bacteria 1159
130 nmdc:mga00v17_5439_c1 3300050491 Bacteria 6708
131 nmdc:mga00v17_58591_c1 3300050491 Bacteria 2360
132 nmdc:mga00v17_835_c1 3300050491 Bacteria 16694
133 nmdc:mga0k408_14321_c1 3300050493 Bacteria 4367
134 nmdc:mga0k408_152115_c1 3300050493 Bacteria 1378
135 nmdc:mga06z11_59497_c1 3300050494 Bacteria 1986
136 nmdc:mga05p37_40390_c1 3300050507 Bacteria 5730
137 nmdc:mga05p37_46427_c1 3300050507 Unclassified 1922
138 nmdc:mga05p37_520347_c1 3300050507 Bacteria 1361
139 nmdc:mga0qj67_21115_c1 3300050509 Bacteria 4992
140 nmdc:mga06r32_283184_c1 3300050510 Unclassified 1645
141 nmdc:mga06r32_360081_c1 3300050510 Unclassified 1439
142 nmdc:mga06r32_645375_c1 3300050510 Bacteria 1027
143 nmdc:mga06r32_85819_c1 3300050510 Archaea 3069
144 nmdc:mga06r32_87788_c1 3300050510 Bacteria 3035
145 nmdc:mga08y16_129673_c1 3300050511 Bacteria 2623
146 nmdc:mga08y16_217068_c1 3300050511 Bacteria 1980
147 nmdc:mga0a205_10424_c1 3300050515 Bacteria 8537
148 nmdc:mga0a205_129218_c1 3300050515 Bacteria 1390
149 nmdc:mga0a205_241762_c1 3300050515 Bacteria 1686
150 nmdc:mga0a205_85806_c1 3300050515 Bacteria 3040
151 Ga0500628_040193 3300053129 Bacteria 1064
152 Ga0501084_0014399 3300054114 Bacteria 6554
153 Ga0590071_003754 3300059421 Bacteria 3725
154 Ga0590074_000364 3300059423 Bacteria 6377
155 Ga0590074_023449 3300059423 Bacteria 1070
156 Ga0590075_000501 3300059424 Bacteria 10628
157 Ga0590077_000162 3300059426 Bacteria 18830
158 Ga0501082_0001062 3300060353 Bacteria 24342
159 Ga0501082_0136868 3300060353 Bacteria 2125
160 Ga0075430_100041735
161 JGI24743J22301_10016063
162 JGI24751J29686_10026170
163 Ga0065712_10092955
164 Ga0070683_100000018
165 Ga0070683_100101800
166 Ga0070670_100022139
167 Ga0070670_100069292
168 Ga0068868_100145623
169 Ga0070675_100104472
170 Ga0070674_100001507
171 Ga0070659_100157964
172 Ga0070667_100200613
173 Ga0070663_100243977
174 Ga0070678_100041180
175 Ga0070685_10266494
176 Ga0070684_100000011
177 Ga0070672_100197276
178 Ga0070695_100157545
179 Ga0068855_100112592
180 Ga0070664_100072658
181 Ga0070664_100192779
182 Ga0068857_100112723
183 Ga0068852_100176524
184 Ga0068859_100182608
185 Ga0081455_10114328
186 Ga0075365_10000761
187 Ga0075365_10049475
188 Ga0075368_10006192
189 Ga0075368_10106995
190 Ga0075364_10007455
191 Ga0075364_10031472
192 Ga0075364_10039751
193 Ga0075367_10054319
194 Ga0075366_10005945
195 Ga0075366_10007165
196 Ga0075366_10090176
197 Ga0075428_100016720
198 Ga0075430_100000745
199 Ga0075430_100007978
200 Ga0075431_100005754
201 Ga0075431_100011956
202 Ga0075431_100058832
203 Ga0075431_100072871
204 Ga0075431_100084222
205 Ga0075431_100101293
206 Ga0075431_100715732
207 Ga0075433_10034347
208 Ga0075433_10047951
209 Ga0075433_10116169
210 Ga0075433_10128384
211 Ga0097620_100182601
212 Ga0111539_10114999
213 Ga0111539_10223636
214 Ga0105245_10226223
215 Ga0114129_10048789
216 Ga0114129_10276243
217 Ga0114129_10580505
218 Ga0157370_10097690
219 Ga0157370_10122124
220 Ga0157369_10023088
221 Ga0157369_10335133
222 Ga0163162_10032205
223 Ga0207697_10001095
224 Ga0207707_10194192
225 Ga0207650_10005118
226 Ga0207659_10134640
227 Ga0207690_10189457
228 Ga0207691_10254908
229 Ga0207661_10000025
230 Ga0207679_10179185
231 Ga0207667_10092410
232 Ga0207658_10091923
233 Ga0207677_10118567
234 Ga0207678_10052591
235 Ga0207674_10065829
236 Ga0207683_10078595
237 Ga0207698_10094608
238 Ga0209813_10053021
239 Ga0307413_10143119
240 Ga0307412_10095004
241 Ga0307409_100407170
242 Ga0307416_100041048
243 Ga0307416_100121174
244 Ga0307416_100205060
245 Ga0307414_10345586
246 Ga0373937_0148571
247 Ga0373937_0523502
248 Ga0373925_0600172
249 Ga0395900_0050971
250 Ga0395905_0014789
251 Ga0395901_0305195
252 Ga0436365_1850237
253 Ga0436363_0942573
254 Ga0439453_0024863
255 Ga0439431_0021974
256 Ga0439433_0004793
257 Ga0450923_009726
258 Ga0439460_0042608
259 Ga0495684_0363597
260 Ga0496102_0030716
261 Ga0496103_0052094
262 Ga0496108_0053691
263 Ga0496112_0081659
264 Ga0496113_0208297
265 Ga0501031_0063025
266 Ga0501032_0214025
267 Ga0501034_0019838
268 Ga0501034_0069782
269 Ga0501036_0142143
270 Ga0501039_0012170
271 Ga0501040_0042847
272 Ga0501046_0299089
273 Ga0501046_0302792
274 Ga0501047_0103610
275 Ga0501069_0262982
276 Ga0501071_0321922
277 Ga0501072_0178823
278 Ga0501074_0024472
279 Ga0501075_0021399
280 Ga0501075_0029464
281 Ga0501075_0040959
282 Ga0501076_0028452
283 Ga0501076_0068576
284 Ga0501079_0269863
285 Ga0501080_0276452
286 Ga0501081_0078021
287 Ga0501045_0031937
288 nmdc:mga03683_122198_c1
289 nmdc:mga00v17_5439_c1
290 nmdc:mga00v17_58591_c1
291 nmdc:mga00v17_835_c1
292 nmdc:mga0k408_14321_c1
293 nmdc:mga0k408_152115_c1
294 nmdc:mga06z11_59497_c1
295 nmdc:mga05p37_40390_c1
296 nmdc:mga05p37_46427_c1
297 nmdc:mga05p37_520347_c1
298 nmdc:mga0qj67_21115_c1
299 nmdc:mga06r32_283184_c1
300 nmdc:mga06r32_360081_c1
301 nmdc:mga06r32_645375_c1
302 nmdc:mga06r32_85819_c1
303 nmdc:mga06r32_87788_c1
304 nmdc:mga08y16_129673_c1
305 nmdc:mga08y16_217068_c1
306 nmdc:mga0a205_10424_c1
307 nmdc:mga0a205_129218_c1
308 nmdc:mga0a205_241762_c1
309 nmdc:mga0a205_85806_c1
310 Ga0500628_040193
311 Ga0501084_0014399
312 Ga0590071_003754
313 Ga0590074_000364
314 Ga0590074_023449
315 Ga0590075_000501
316 Ga0590077_000162
317 Ga0501082_0001062
318 Ga0501082_0136868

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

30

129

0.86

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

29

309

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mih-assembly2.cif.gz_H pyranose 2-oxidase from phanerochaete chrysosporium, recombinant h158a mutant 0.9422 2 33
4ntd-assembly1.cif.gz_A-2 crystal structure of hlmi 0.9394 2 298
4jna-assembly2.cif.gz_B crystal structure of the deph complex with dimethyl-fk228 0.9337 1 294
4fk1-assembly1.cif.gz_B crystal structure of putative thioredoxin reductase trxb from bacillus anthracis 0.9317 2 297
4nte-assembly1.cif.gz_A crystal structure of deph 0.9308 2 294
ID Description Score Start End Superfamily
af_O60112_6_422_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.9389 1 32 3.30.300.30
4ntcB01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9346 2 295 3.50.50.60
4ntdA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9335 115 224 3.50.50.60
3fbsA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9245 2 294 3.50.50.60
4jnaA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9205 2 294 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7V8XNW7-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9772 52 299 GO:0016491
AF-A0A1M5BCI6-F1-model_v4 Thioredoxin reductase 0.9749 2 296 GO:0016491
AF-A0A7V9DZS0-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9741 2 298 GO:0016491
AF-A0A6N7PYE4-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9736 2 298 GO:0016491
AF-A0A0E3ZF91-F1-model_v4 Pyridine nucleotide-disulfide oxidoreductase 0.9734 1 299 GO:0016491

Map