F231679

General Info

Members Datasets Scaffolds Average Seq Length
159 128 159 137

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100883249|Ga0070665_1008832492
Length 153
Sequence MTRMPGTWPASSAKTGNPTELLLLDASVWVAAGIPGNPAHESAAALAHGGVSVAALDLTLYEVVNAVARGYRQPEQAQKIARAMLRTCGEDLIRVDRELGEEIAKAVSEHGLTAYDAAYVAAARRNGWQLVSLDVRDLVSKGLAVTPDAADYP

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
63 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
66 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
67 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
68 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
69 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
70 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
71 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
74 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
123 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
124 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 9.43
Rhizosphere 86.16
Stem 0
Stem Tuber 0
Unclassified 2.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1007692 3300000532 Unclassified 702
2 LJNas_1001656 3300000546 Bacteria 3017
3 JGI24746J21847_1001399 3300001977 Bacteria 3847
4 JGI24740J21852_10003738 3300001979 Bacteria 6624
5 JGI25406J46586_10108406 3300003203 Bacteria 823
6 Ga0070676_11335230 3300005328 Unclassified 548
7 Ga0070683_100005111 3300005329 Bacteria 10909
8 Ga0070682_100046445 3300005337 Bacteria 2695
9 Ga0068868_100000033 3300005338 Bacteria 75402
10 Ga0070691_10000036 3300005341 Bacteria 38327
11 Ga0070692_10064876 3300005345 Bacteria 1932
12 Ga0070674_100000002 3300005356 Bacteria 271088
13 Ga0070667_100144608 3300005367 Bacteria 2084
14 Ga0070667_100207152 3300005367 Bacteria 1742
15 Ga0070714_100089144 3300005435 Bacteria 2700
16 Ga0070710_11056118 3300005437 Bacteria 594
17 Ga0070711_100160760 3300005439 Bacteria 1702
18 Ga0070700_100055479 3300005441 Bacteria 2480
19 Ga0070678_100865294 3300005456 Bacteria 824
20 Ga0070662_100000002 3300005457 Bacteria 253208
21 Ga0070698_101111864 3300005471 Bacteria 739
22 Ga0070684_100035744 3300005535 Bacteria 4254
23 Ga0070684_100048419 3300005535 Bacteria 3688
24 Ga0070684_100484337 3300005535 Bacteria 1145
25 Ga0070665_100003676 3300005548 Bacteria 16257
26 Ga0070665_100164043 3300005548 Bacteria 2224
27 Ga0070665_100813924 3300005548 Bacteria 947
28 Ga0070665_100883249 3300005548 Bacteria 907
29 Ga0068855_100252014 3300005563 Bacteria 1969
30 Ga0070702_100020017 3300005615 Bacteria 3500
31 Ga0068852_100029435 3300005616 Bacteria 4512
32 Ga0068864_100000015 3300005618 Bacteria 303368
33 Ga0068858_100000069 3300005842 Bacteria 105617
34 Ga0068860_100134952 3300005843 Bacteria 2370
35 Ga0081455_10031059 3300005937 Bacteria 4839
36 Ga0081539_10003959 3300005985 Bacteria 17145
37 Ga0097621_100264699 3300006237 Bacteria 1509
38 Ga0068865_100000042 3300006881 Bacteria 71057
39 Ga0105242_10000062 3300009176 Bacteria 74936
40 Ga0105242_10000595 3300009176 Bacteria 28423
41 Ga0105249_10412492 3300009553 Bacteria 1383
42 Ga0105239_10035264 3300010375 Bacteria 5494
43 Ga0157370_10018997 3300013104 Bacteria 6910
44 Ga0157370_10264502 3300013104 Bacteria 1589
45 Ga0157378_10034276 3300013297 Bacteria 4489
46 Ga0157380_10751285 3300014326 Bacteria 987
47 Ga0154015_1703871 3300020610 Bacteria 1271
48 Ga0207680_10016234 3300025903 Bacteria 3904
49 Ga0207680_10103454 3300025903 Bacteria 1834
50 Ga0207659_10000022 3300025926 Bacteria 143432
51 Ga0207700_10000003 3300025928 Bacteria 500797
52 Ga0207706_10000001 3300025933 Bacteria 423014
53 Ga0207686_10000231 3300025934 Bacteria 42432
54 Ga0207709_10003457 3300025935 Bacteria 9374
55 Ga0207704_10000181 3300025938 Bacteria 33316
56 Ga0207661_10000241 3300025944 Bacteria 35538
57 Ga0207661_10009386 3300025944 Bacteria 7014
58 Ga0207661_10074551 3300025944 Bacteria 2781
59 Ga0207667_10243022 3300025949 Bacteria 1842
60 Ga0207712_10304412 3300025961 Bacteria 1309
61 Ga0207658_10175272 3300025986 Bacteria 1770
62 Ga0207658_10357032 3300025986 Bacteria 1274
63 Ga0207677_10000343 3300026023 Bacteria 33031
64 Ga0207703_10000169 3300026035 Bacteria 76131
65 Ga0207708_10089065 3300026075 Bacteria 2378
66 Ga0207676_10000018 3300026095 Bacteria 306375
67 Ga0207674_10081127 3300026116 Bacteria 3246
68 Ga0268266_10001210 3300028379 Bacteria 31835
69 Ga0268266_10027403 3300028379 Bacteria 4845
70 Ga0268266_10551187 3300028379 Bacteria 1105
71 Ga0268264_10015434 3300028381 Bacteria 6264
72 Ga0307415_100956292 3300032126 Bacteria 793
73 Ga0373955_0080493 3300035172 Bacteria 1840
74 Ga0373937_0109449 3300036401 Bacteria 2569
75 Ga0451802_2061388 3300041460 Bacteria 728
76 Ga0451807_0647070 3300041486 Bacteria 516
77 Ga0466957_0223450 3300044842 Bacteria 1244
78 Ga0466967_0000006 3300045976 Bacteria 144065
79 Ga0495603_0000033 3300046455 Bacteria 57940
80 Ga0495603_0002227 3300046455 Bacteria 11397
81 Ga0495603_0224991 3300046455 Bacteria 1082
82 Ga0495629_0004716 3300046459 Bacteria 10215
83 Ga0495638_0042002 3300046460 Bacteria 2890
84 Ga0495662_0005247 3300046476 Bacteria 6495
85 Ga0495608_0000035 3300046511 Bacteria 133011
86 Ga0495628_0039933 3300046516 Bacteria 3752
87 Ga0495628_0195744 3300046516 Bacteria 1525
88 Ga0495628_0282072 3300046516 Bacteria 1233
89 Ga0495625_0000032 3300046660 Bacteria 233135
90 Ga0495625_0208330 3300046660 Unclassified 1286
91 Ga0495635_0487536 3300046663 Bacteria 812
92 Ga0495588_0000229 3300046674 Bacteria 50351
93 Ga0495657_0000026 3300046675 Bacteria 133011
94 Ga0495613_0001530 3300046689 Bacteria 17607
95 Ga0495671_0267697 3300046692 Bacteria 824
96 Ga0495600_0023859 3300046809 Bacteria 3935
97 Ga0495604_0000305 3300047317 Bacteria 44020
98 Ga0495604_0155355 3300047317 Bacteria 1621
99 Ga0495680_0095087 3300047322 Bacteria 2228
100 Ga0495675_0000015 3300047444 Bacteria 133004
101 Ga0495675_0211234 3300047444 Bacteria 1178
102 Ga0495602_0000227 3300048088 Bacteria 52680
103 Ga0496102_0002490 3300048905 Bacteria 15727
104 Ga0496103_0000057 3300048906 Bacteria 142223
105 Ga0496104_0000015 3300048907 Bacteria 374530
106 Ga0496104_0045264 3300048907 Bacteria 4138
107 Ga0496105_0000004 3300048908 Bacteria 475798
108 Ga0496106_0000356 3300048909 Bacteria 32385
109 Ga0496107_0164008 3300048910 Bacteria 1648
110 Ga0496108_0000232 3300048911 Bacteria 49846
111 Ga0496108_0010260 3300048911 Bacteria 7604
112 Ga0496109_0000044 3300048912 Bacteria 133779
113 Ga0496109_0000462 3300048912 Bacteria 34785
114 Ga0496110_0071413 3300048913 Bacteria 3078
115 Ga0496111_0339192 3300048914 Bacteria 1112
116 Ga0496119_0247758 3300048922 Unclassified 899
117 Ga0496120_0006686 3300048923 Bacteria 8782
118 Ga0496126_0011501 3300048929 Bacteria 9151
119 Ga0496126_0569242 3300048929 Archaea 896
120 Ga0501032_0004713 3300049569 Bacteria 10232
121 Ga0501033_0000534 3300049570 Bacteria 35503
122 Ga0501034_0027350 3300049571 Bacteria 5800
123 Ga0501036_0005643 3300049572 Bacteria 10150
124 Ga0501037_0004502 3300049573 Bacteria 10130
125 Ga0501038_0007396 3300049574 Bacteria 10128
126 Ga0501039_0035782 3300049575 Bacteria 3832
127 Ga0501040_0261826 3300049576 Bacteria 1234
128 Ga0501043_0000291 3300049579 Bacteria 45276
129 Ga0501046_0010973 3300049580 Bacteria 7768
130 Ga0501047_0000313 3300049581 Bacteria 55964
131 Ga0501047_0004429 3300049581 Bacteria 13226
132 Ga0501048_0004802 3300049582 Bacteria 10298
133 Ga0501067_0566688 3300049583 Bacteria 636
134 Ga0501068_0009843 3300049584 Bacteria 5354
135 Ga0501068_0516348 3300049584 Bacteria 775
136 Ga0501069_0009708 3300049585 Bacteria 5084
137 Ga0501070_0006008 3300049586 Bacteria 10340
138 Ga0501070_0049701 3300049586 Bacteria 3482
139 Ga0501070_0169038 3300049586 Bacteria 1801
140 Ga0501072_0130734 3300049588 Bacteria 2001
141 Ga0501073_0004165 3300049589 Bacteria 10847
142 Ga0501074_0027191 3300049590 Bacteria 4147
143 Ga0501079_0337464 3300049741 Bacteria 1180
144 Ga0501080_0224185 3300049742 Bacteria 1719
145 Ga0501083_0004241 3300049744 Bacteria 10091
146 Ga0501035_0000736 3300049822 Bacteria 35413
147 Ga0501044_0001624 3300049823 Bacteria 26339
148 Ga0501045_0133258 3300049824 Bacteria 1847
149 Ga0495601_0000057 3300053077 Bacteria 61510
150 Ga0495601_0111526 3300053077 Bacteria 1772
151 Ga0495612_0006786 3300053078 Bacteria 4690
152 Ga0495655_0040436 3300053083 Bacteria 1187
153 Ga0495595_0000017 3300053084 Bacteria 133011
154 Ga0495595_0013603 3300053084 Bacteria 3440
155 Ga0495619_0001050 3300053085 Bacteria 18097
156 Ga0500566_0000943 3300053094 Bacteria 16679
157 Ga0500641_0051984 3300053096 Bacteria 1687
158 Ga0500595_012921 3300053119 Bacteria 3212
159 Ga0501082_0043231 3300060353 Bacteria 3884

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10264502 Ga0157370_102645022 109
2 3300025935 Ga0207709_10003457 Ga0207709_100034577 124
3 3300005615 Ga0070702_100020017 Ga0070702_1000200172 127
4 3300006881 Ga0068865_100000042 Ga0068865_10000004244 127
5 3300025938 Ga0207704_10000181 Ga0207704_1000018123 127
6 3300005328 Ga0070676_11335230 Ga0070676_113352301 131
7 3300005337 Ga0070682_100046445 Ga0070682_1000464453 131
8 3300005367 Ga0070667_100144608 Ga0070667_1001446083 131
9 3300006237 Ga0097621_100264699 Ga0097621_1002646993 131
10 3300025986 Ga0207658_10175272 Ga0207658_101752723 131
11 3300041460 Ga0451802_2061388 Ga0451802_2061388_19_414 131
12 3300046660 Ga0495625_0208330 Ga0495625_0208330_456_854 131
13 3300053096 Ga0500641_0051984 Ga0500641_0051984_442_840 131
14 3300005367 Ga0070667_100207152 Ga0070667_1002071522 132
15 3300005548 Ga0070665_100164043 Ga0070665_1001640433 132
16 3300005937 Ga0081455_10031059 Ga0081455_100310593 132
17 3300020610 Ga0154015_1703871 Ga0154015_17038712 132
18 3300025903 Ga0207680_10103454 Ga0207680_101034542 132
19 3300025986 Ga0207658_10357032 Ga0207658_103570321 132
20 3300028379 Ga0268266_10027403 Ga0268266_100274036 132
21 3300046460 Ga0495638_0042002 Ga0495638_0042002_926_1324 132
22 3300046689 Ga0495613_0001530 Ga0495613_0001530_7590_7991 132
23 3300046692 Ga0495671_0267697 Ga0495671_0267697_361_798 132
24 3300048923 Ga0496120_0006686 Ga0496120_0006686_6451_6888 132
25 3300048929 Ga0496126_0011501 Ga0496126_0011501_2682_3089 132
26 3300048929 Ga0496126_0569242 Ga0496126_0569242_415_840 132
27 3300049569 Ga0501032_0004713 Ga0501032_0004713_9210_9647 132
28 3300049570 Ga0501033_0000534 Ga0501033_0000534_9316_9753 132
29 3300049571 Ga0501034_0027350 Ga0501034_0027350_5316_5753 132
30 3300049572 Ga0501036_0005643 Ga0501036_0005643_9205_9642 132
31 3300049573 Ga0501037_0004502 Ga0501037_0004502_500_937 132
32 3300049574 Ga0501038_0007396 Ga0501038_0007396_9222_9659 132
33 3300049575 Ga0501039_0035782 Ga0501039_0035782_2949_3386 132
34 3300049576 Ga0501040_0261826 Ga0501040_0261826_205_642 132
35 3300049579 Ga0501043_0000291 Ga0501043_0000291_35641_36078 132
36 3300049580 Ga0501046_0010973 Ga0501046_0010973_6596_7033 132
37 3300049581 Ga0501047_0000313 Ga0501047_0000313_9228_9665 132
38 3300049581 Ga0501047_0004429 Ga0501047_0004429_7086_7523 132
39 3300049582 Ga0501048_0004802 Ga0501048_0004802_9143_9580 132
40 3300049583 Ga0501067_0566688 Ga0501067_0566688_43_480 132
41 3300049584 Ga0501068_0009843 Ga0501068_0009843_4438_4875 132
42 3300049585 Ga0501069_0009708 Ga0501069_0009708_325_762 132
43 3300049586 Ga0501070_0006008 Ga0501070_0006008_699_1136 132
44 3300049586 Ga0501070_0049701 Ga0501070_0049701_2139_2573 132
45 3300049586 Ga0501070_0169038 Ga0501070_0169038_1303_1740 132
46 3300049588 Ga0501072_0130734 Ga0501072_0130734_462_899 132
47 3300049589 Ga0501073_0004165 Ga0501073_0004165_9138_9575 132
48 3300049590 Ga0501074_0027191 Ga0501074_0027191_3030_3467 132
49 3300049741 Ga0501079_0337464 Ga0501079_0337464_455_892 132
50 3300049742 Ga0501080_0224185 Ga0501080_0224185_742_1179 132
51 3300049744 Ga0501083_0004241 Ga0501083_0004241_9191_9628 132
52 3300049822 Ga0501035_0000736 Ga0501035_0000736_9206_9643 132
53 3300049823 Ga0501044_0001624 Ga0501044_0001624_25191_25628 132
54 3300049824 Ga0501045_0133258 Ga0501045_0133258_1052_1489 132
55 3300053077 Ga0495601_0000057 Ga0495601_0000057_9600_10001 132
56 3300053083 Ga0495655_0040436 Ga0495655_0040436_15_437 132
57 3300053119 Ga0500595_012921 Ga0500595_012921_1809_2243 132
58 3300060353 Ga0501082_0043231 Ga0501082_0043231_408_845 132
59 3300005435 Ga0070714_100089144 Ga0070714_1000891443 133
60 3300005439 Ga0070711_100160760 Ga0070711_1001607603 133
61 3300005535 Ga0070684_100484337 Ga0070684_1004843372 133
62 3300005548 Ga0070665_100883249 Ga0070665_1008832492 133
63 3300005616 Ga0068852_100029435 Ga0068852_1000294356 133
64 3300005843 Ga0068860_100134952 Ga0068860_1001349524 133
65 3300013104 Ga0157370_10018997 Ga0157370_100189975 133
66 3300013297 Ga0157378_10034276 Ga0157378_100342763 133
67 3300025903 Ga0207680_10016234 Ga0207680_100162343 133
68 3300025928 Ga0207700_10000003 Ga0207700_10000003473 133
69 3300028381 Ga0268264_10015434 Ga0268264_100154343 133
70 3300032126 Ga0307415_100956292 Ga0307415_1009562921 133
71 3300041486 Ga0451807_0647070 Ga0451807_0647070_36_437 133
72 3300044842 Ga0466957_0223450 Ga0466957_0223450_59_547 133
73 3300046476 Ga0495662_0005247 Ga0495662_0005247_4420_4821 133
74 3300046511 Ga0495608_0000035 Ga0495608_0000035_9526_9930 133
75 3300046674 Ga0495588_0000229 Ga0495588_0000229_28313_28714 133
76 3300046675 Ga0495657_0000026 Ga0495657_0000026_123082_123486 133
77 3300047317 Ga0495604_0155355 Ga0495604_0155355_217_621 133
78 3300047444 Ga0495675_0000015 Ga0495675_0000015_123075_123479 133
79 3300048088 Ga0495602_0000227 Ga0495602_0000227_42954_43358 133
80 3300049584 Ga0501068_0516348 Ga0501068_0516348_128_529 133
81 3300053077 Ga0495601_0111526 Ga0495601_0111526_604_1005 133
82 3300053084 Ga0495595_0000017 Ga0495595_0000017_123082_123486 133
83 3300053084 Ga0495595_0013603 Ga0495595_0013603_222_626 133
84 3300053085 Ga0495619_0001050 Ga0495619_0001050_8168_8572 133
85 3300000532 CNAas_1007692 CNAas_10076922 134
86 3300000546 LJNas_1001656 LJNas_10016565 134
87 3300001977 JGI24746J21847_1001399 JGI24746J21847_10013995 134
88 3300001979 JGI24740J21852_10003738 JGI24740J21852_100037389 134
89 3300003203 JGI25406J46586_10108406 JGI25406J46586_101084061 134
90 3300005329 Ga0070683_100005111 Ga0070683_10000511111 134
91 3300005338 Ga0068868_100000033 Ga0068868_10000003341 134
92 3300005341 Ga0070691_10000036 Ga0070691_1000003619 134
93 3300005345 Ga0070692_10064876 Ga0070692_100648764 134
94 3300005356 Ga0070674_100000002 Ga0070674_100000002147 134
95 3300005437 Ga0070710_11056118 Ga0070710_110561182 134
96 3300005441 Ga0070700_100055479 Ga0070700_1000554793 134
97 3300005456 Ga0070678_100865294 Ga0070678_1008652941 134
98 3300005457 Ga0070662_100000002 Ga0070662_10000000249 134
99 3300005471 Ga0070698_101111864 Ga0070698_1011118641 134
100 3300005535 Ga0070684_100035744 Ga0070684_1000357445 134
101 3300005535 Ga0070684_100048419 Ga0070684_1000484194 134
102 3300005548 Ga0070665_100003676 Ga0070665_10000367610 134
103 3300005548 Ga0070665_100813924 Ga0070665_1008139242 134
104 3300005563 Ga0068855_100252014 Ga0068855_1002520143 134
105 3300005618 Ga0068864_100000015 Ga0068864_10000001520 134
106 3300005842 Ga0068858_100000069 Ga0068858_10000006934 134
107 3300005985 Ga0081539_10003959 Ga0081539_1000395912 134
108 3300009176 Ga0105242_10000062 Ga0105242_1000006271 134
109 3300009176 Ga0105242_10000595 Ga0105242_1000059520 134
110 3300009553 Ga0105249_10412492 Ga0105249_104124922 134
111 3300010375 Ga0105239_10035264 Ga0105239_100352646 134
112 3300014326 Ga0157380_10751285 Ga0157380_107512853 134
113 3300025926 Ga0207659_10000022 Ga0207659_100000227 134
114 3300025933 Ga0207706_10000001 Ga0207706_10000001229 134
115 3300025934 Ga0207686_10000231 Ga0207686_1000023117 134
116 3300025944 Ga0207661_10000241 Ga0207661_1000024112 134
117 3300025944 Ga0207661_10009386 Ga0207661_1000938610 134
118 3300025944 Ga0207661_10074551 Ga0207661_100745514 134
119 3300025949 Ga0207667_10243022 Ga0207667_102430222 134
120 3300025961 Ga0207712_10304412 Ga0207712_103044123 134
121 3300026023 Ga0207677_10000343 Ga0207677_1000034332 134
122 3300026035 Ga0207703_10000169 Ga0207703_1000016914 134
123 3300026075 Ga0207708_10089065 Ga0207708_100890653 134
124 3300026095 Ga0207676_10000018 Ga0207676_10000018280 134
125 3300026116 Ga0207674_10081127 Ga0207674_100811273 134
126 3300028379 Ga0268266_10001210 Ga0268266_100012103 134
127 3300028379 Ga0268266_10551187 Ga0268266_105511872 134
128 3300035172 Ga0373955_0080493 Ga0373955_0080493_115_525 134
129 3300036401 Ga0373937_0109449 Ga0373937_0109449_1066_1476 134
130 3300045976 Ga0466967_0000006 Ga0466967_0000006_69663_70076 134
131 3300046455 Ga0495603_0000033 Ga0495603_0000033_55658_56062 134
132 3300046455 Ga0495603_0002227 Ga0495603_0002227_4468_4872 134
133 3300046455 Ga0495603_0224991 Ga0495603_0224991_425_835 134
134 3300046459 Ga0495629_0004716 Ga0495629_0004716_2437_2847 134
135 3300046516 Ga0495628_0039933 Ga0495628_0039933_357_776 134
136 3300046516 Ga0495628_0195744 Ga0495628_0195744_778_1182 134
137 3300046516 Ga0495628_0282072 Ga0495628_0282072_779_1183 134
138 3300046660 Ga0495625_0000032 Ga0495625_0000032_92145_92552 134
139 3300046663 Ga0495635_0487536 Ga0495635_0487536_81_500 134
140 3300046809 Ga0495600_0023859 Ga0495600_0023859_2278_2700 134
141 3300047317 Ga0495604_0000305 Ga0495604_0000305_16983_17396 134
142 3300047322 Ga0495680_0095087 Ga0495680_0095087_603_1007 134
143 3300047444 Ga0495675_0211234 Ga0495675_0211234_740_1153 134
144 3300048905 Ga0496102_0002490 Ga0496102_0002490_10500_10904 134
145 3300048906 Ga0496103_0000057 Ga0496103_0000057_101251_101655 134
146 3300048907 Ga0496104_0000015 Ga0496104_0000015_20814_21221 134
147 3300048907 Ga0496104_0045264 Ga0496104_0045264_2476_2889 134
148 3300048908 Ga0496105_0000004 Ga0496105_0000004_454578_454985 134
149 3300048909 Ga0496106_0000356 Ga0496106_0000356_30095_30505 134
150 3300048910 Ga0496107_0164008 Ga0496107_0164008_63_473 134
151 3300048911 Ga0496108_0000232 Ga0496108_0000232_35954_36358 134
152 3300048911 Ga0496108_0010260 Ga0496108_0010260_2531_2938 134
153 3300048912 Ga0496109_0000044 Ga0496109_0000044_119862_120266 134
154 3300048912 Ga0496109_0000462 Ga0496109_0000462_4799_5206 134
155 3300048913 Ga0496110_0071413 Ga0496110_0071413_787_1206 134
156 3300048914 Ga0496111_0339192 Ga0496111_0339192_268_687 134
157 3300048922 Ga0496119_0247758 Ga0496119_0247758_249_656 134
158 3300053078 Ga0495612_0006786 Ga0495612_0006786_961_1371 134
159 3300053094 Ga0500566_0000943 Ga0500566_0000943_6388_6798 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

22

140

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x3t-assembly1.cif.gz_H vapbc from mycobacterium tuberculosis 0.825 2 115
5wz4-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis vapc20 (rv2549c), sarcin-ricin loop cleaving toxin 0.8105 1 123
1w8i-assembly1.cif.gz_A-2 the structure of gene product af1683 from archaeoglobus fulgidus. 0.7871 1 115
4xgr-assembly1.cif.gz_A crystal structure of addiction module from mycobacterial species 0.7863 1 112
4xgq-assembly2.cif.gz_G crystal structure of addiction module from mycobacterial species 0.7839 1 112
ID Description Score Start End Superfamily
af_P9WFA1_1_129_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8409 1 115 3.40.50.1010
af_P9WFB3_1_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8245 1 128 3.40.50.1010
af_O53779_1_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8199 3 117 3.40.50.1010
af_P9WF89_1_125_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8136 1 115 3.40.50.1010
af_P95004_1_128_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8058 1 125 3.40.50.1010
ID Description Score Start End GO Terms
AF-D3F539-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9754 2 129 GO:0000287
GO:0004540
GO:0090729
AF-A0A537YV14-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9721 1 134 GO:0000287
GO:0004540
GO:0090729
AF-A0A1Q3NFH6-F1-model_v4 deleted 0.9681 2 128
AF-A0A537YV14-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.965 1 134 GO:0000287
GO:0004540
GO:0090729
AF-A0A1M3BN30-F1-model_v4 PIN domain-containing protein 0.9493 29 131 GO:0004518

Feature Viewer

pLDDT pTM Quality
96.05 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map