F231412

General Info

Members Datasets Scaffolds Average Seq Length
159 133 318 171

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100309514|Ga0070671_1003095142
Length 199
Sequence MYRDVSHHDLSVPMLSGLIEIAPPGQLRLCGHMLIRAEERRDWAAVHAVNVSAFDTSAEANLVDALREQAQPPVSLVAEDNGAIVGHIMFSPVSLSGHPALRIIGLAPMAVAPAHQRKGIGSALVRAGLEQCKQLGFGAVVVLGHPAYYPRFGFFSSARFGIGCEYDVPEEVFMVVELRAGFLKGASGTVKYHAAFSDV

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
63 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
71 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
72 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
79 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
80 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
87 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
88 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
91 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
118 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
122 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
128 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
129 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
130 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
131 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
132 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
133 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.86
Metatranscriptomes 0
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0
Rhizoplane 4.4
Rhizosphere 85.53
Stem 0
Stem Tuber 0
Unclassified 14.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100309514 3300005355 Bacteria 1345
2 JGI25151J46595_10001991 3300003187 Bacteria 12803
3 Ga0065712_10093472 3300005290 Bacteria 2291
4 Ga0070658_10159787 3300005327 Bacteria 1890
5 Ga0070670_100825694 3300005331 Bacteria 838
6 Ga0068869_100027461 3300005334 Bacteria 3968
7 Ga0068869_100801858 3300005334 Bacteria 809
8 Ga0070689_100316695 3300005340 Bacteria 1302
9 Ga0070671_100021325 3300005355 Bacteria 5292
10 Ga0070673_100174441 3300005364 Bacteria 1837
11 Ga0070688_100134184 3300005365 Bacteria 1674
12 Ga0070667_100009883 3300005367 Bacteria 7910
13 Ga0070705_100794778 3300005440 Unclassified 752
14 Ga0070694_100983925 3300005444 Unclassified 700
15 Ga0070698_100003024 3300005471 Bacteria 18537
16 Ga0070699_100001954 3300005518 Bacteria 18634
17 Ga0070699_100164794 3300005518 Bacteria 1963
18 Ga0070699_100453153 3300005518 Bacteria 1163
19 Ga0070697_101245828 3300005536 Unclassified 663
20 Ga0070696_100039080 3300005546 Bacteria 3277
21 Ga0070696_100041819 3300005546 Unclassified 3167
22 Ga0070693_100906314 3300005547 Unclassified 661
23 Ga0070704_100408928 3300005549 Bacteria 1160
24 Ga0070664_100184307 3300005564 Bacteria 1857
25 Ga0068854_100025705 3300005578 Bacteria 4040
26 Ga0068859_100104048 3300005617 Bacteria 2897
27 Ga0068859_100208451 3300005617 Bacteria 2040
28 Ga0068864_100172903 3300005618 Bacteria 1971
29 Ga0068864_100476451 3300005618 Bacteria 1197
30 Ga0068863_100396723 3300005841 Bacteria 1349
31 Ga0068858_100212984 3300005842 Bacteria 1828
32 Ga0068860_100023877 3300005843 Bacteria 5911
33 Ga0068862_100052836 3300005844 Bacteria 3477
34 Ga0075365_10006436 3300006038 Bacteria 6463
35 Ga0075364_10117540 3300006051 Bacteria 1778
36 Ga0075428_100124953 3300006844 Bacteria 2800
37 Ga0075428_100294000 3300006844 Bacteria 1747
38 Ga0075428_101042497 3300006844 Bacteria 865
39 Ga0075430_100167768 3300006846 Unclassified 1826
40 Ga0075431_100091830 3300006847 Bacteria 3133
41 Ga0068865_100470168 3300006881 Bacteria 1043
42 Ga0097620_100104046 3300006931 Bacteria 2897
43 Ga0097620_100208454 3300006931 Bacteria 2040
44 Ga0105245_11097436 3300009098 Unclassified 842
45 Ga0105247_10053104 3300009101 Bacteria 2499
46 Ga0114129_10043886 3300009147 Bacteria 6290
47 Ga0114129_10135893 3300009147 Unclassified 3373
48 Ga0105243_11449372 3300009148 Bacteria 709
49 Ga0105242_10139219 3300009176 Bacteria 2104
50 Ga0105248_10000831 3300009177 Bacteria 34676
51 Ga0105248_10003374 3300009177 Bacteria 17740
52 Ga0105248_10936482 3300009177 Bacteria 978
53 Ga0105238_10367385 3300009551 Bacteria 1429
54 Ga0105249_10091055 3300009553 Bacteria 2853
55 Ga0105249_11065643 3300009553 Unclassified 878
56 Ga0105249_11448062 3300009553 Unclassified 759
57 Ga0157378_10076458 3300013297 Bacteria 3017
58 Ga0163162_10006571 3300013306 Bacteria 11265
59 Ga0157375_10116635 3300013308 Bacteria 2775
60 Ga0163163_10002720 3300014325 Bacteria 14933
61 Ga0163163_10010970 3300014325 Bacteria 8188
62 Ga0157380_10774164 3300014326 Unclassified 974
63 Ga0209025_1000673 3300025294 Bacteria 58896
64 Ga0207710_10014723 3300025900 Bacteria 3302
65 Ga0207705_10425908 3300025909 Bacteria 1028
66 Ga0207681_10105619 3300025923 Bacteria 2039
67 Ga0207659_10116258 3300025926 Unclassified 2042
68 Ga0207687_10729370 3300025927 Unclassified 842
69 Ga0207644_10157009 3300025931 Bacteria 1765
70 Ga0207644_10244906 3300025931 Bacteria 1428
71 Ga0207670_10672864 3300025936 Unclassified 855
72 Ga0207711_10036111 3300025941 Bacteria 4192
73 Ga0207689_10304119 3300025942 Bacteria 1322
74 Ga0207689_11025368 3300025942 Bacteria 696
75 Ga0207651_10113248 3300025960 Bacteria 2041
76 Ga0207658_10093295 3300025986 Bacteria 2340
77 Ga0207676_10135789 3300026095 Bacteria 2098
78 Ga0207676_10543865 3300026095 Unclassified 1109
79 Ga0207675_102122041 3300026118 Bacteria 578
80 Ga0268265_10146149 3300028380 Bacteria 1987
81 Ga0268265_12024984 3300028380 Bacteria 583
82 Ga0265332_10001079 3300031238 Bacteria 15953
83 Ga0265325_10051669 3300031241 Unclassified 2113
84 Ga0265327_10002177 3300031251 Bacteria 21553
85 Ga0307513_10379723 3300031456 Bacteria 1153
86 Ga0307405_10226357 3300031731 Bacteria 1376
87 Ga0307413_11154316 3300031824 Bacteria 671
88 Ga0307410_11305796 3300031852 Bacteria 635
89 Ga0307414_10948079 3300032004 Bacteria 790
90 Ga0307510_10145186 3300033180 Bacteria 2007
91 Ga0316582_0034960 3300036647 Bacteria 3099
92 Ga0439447_007656 3300041407 Bacteria 3403
93 Ga0466972_0321608 3300044658 Bacteria 723
94 Ga0453684_0196391 3300044712 Bacteria 2356
95 Ga0495580_0281978 3300046472 Bacteria 1133
96 Ga0495582_0069178 3300046473 Unclassified 1952
97 Ga0495664_0433097 3300046477 Unclassified 788
98 Ga0495663_0020745 3300046525 Bacteria 1888
99 Ga0495621_0397968 3300046539 Unclassified 584
100 Ga0495668_0003096 3300046616 Bacteria 12854
101 Ga0496104_0554082 3300048907 Unclassified 1060
102 Ga0496104_0713731 3300048907 Unclassified 910
103 Ga0496105_0544066 3300048908 Unclassified 907
104 Ga0496108_0068509 3300048911 Bacteria 2994
105 Ga0496109_0145557 3300048912 Bacteria 2217
106 Ga0496112_0014831 3300048915 Bacteria 7247
107 Ga0496116_0001413 3300048919 Bacteria 26962
108 Ga0496117_0000289 3300048920 Bacteria 90202
109 Ga0496118_0188810 3300048921 Bacteria 1235
110 Ga0496122_0002303 3300048925 Bacteria 27558
111 Ga0496124_0165949 3300048927 Bacteria 1716
112 Ga0496126_0621566 3300048929 Bacteria 849
113 Ga0501031_0005593 3300049568 Bacteria 8191
114 Ga0501033_0016324 3300049570 Bacteria 5624
115 Ga0501034_0422216 3300049571 Bacteria 1254
116 Ga0501036_0005831 3300049572 Bacteria 9972
117 Ga0501037_0073237 3300049573 Bacteria 2490
118 Ga0501038_0003218 3300049574 Bacteria 15235
119 Ga0501039_0008312 3300049575 Bacteria 7908
120 Ga0501040_0000631 3300049576 Bacteria 21526
121 Ga0501041_0000459 3300049577 Bacteria 20658
122 Ga0501042_0004651 3300049578 Bacteria 8759
123 Ga0501043_0006508 3300049579 Bacteria 9373
124 Ga0501046_0007522 3300049580 Bacteria 9557
125 Ga0501047_0830917 3300049581 Bacteria 738
126 Ga0501048_0000457 3300049582 Bacteria 28577
127 Ga0501068_0027408 3300049584 Bacteria 3364
128 Ga0501069_0399135 3300049585 Bacteria 814
129 Ga0501070_0021522 3300049586 Bacteria 5410
130 Ga0501071_0000456 3300049587 Bacteria 20604
131 Ga0501072_0001602 3300049588 Bacteria 16913
132 Ga0501072_0767482 3300049588 Unclassified 756
133 Ga0501073_0046188 3300049589 Bacteria 3064
134 Ga0501074_0002370 3300049590 Bacteria 13122
135 Ga0501075_0589468 3300049591 Bacteria 848
136 Ga0501077_0000456 3300049593 Bacteria 24833
137 Ga0501079_0000036 3300049741 Bacteria 57722
138 Ga0501080_0000401 3300049742 Bacteria 33489
139 Ga0501081_0000154 3300049743 Bacteria 31349
140 Ga0501083_0029962 3300049744 Bacteria 3739
141 Ga0501035_0077174 3300049822 Bacteria 2944
142 Ga0501044_0535776 3300049823 Bacteria 1069
143 Ga0501045_0000013 3300049824 Bacteria 73989
144 nmdc:mga0yw44_10420_c1 3300050492 Bacteria 4748
145 nmdc:mga05p37_7753_c1 3300050507 Bacteria 12669
146 nmdc:mga0qj67_198935_c1 3300050509 Bacteria 1628
147 nmdc:mga0qj67_52765_c1 3300050509 Bacteria 3218
148 nmdc:mga06r32_19568_c1 3300050510 Bacteria 6216
149 nmdc:mga06r32_82418_c1 3300050510 Bacteria 3133
150 Ga0501084_0000346 3300054114 Bacteria 35396
151 Ga0501084_0207767 3300054114 Bacteria 1652
152 Ga0501082_0003011 3300060353 Bacteria 14718
153 Ga0501082_0605942 3300060353 Bacteria 958
154 Ga0530510_0012277 3300061734 Bacteria 6013
155 2691329723 2690315857 Bacteria 4396207
156 2722728510 2721755487 Bacteria 6357185
157 2757564887 2757320391 Bacteria 4746095
158 2777836921 2775507192 Bacteria 4622234
159 2919536414 2919534386 Bacteria 4577686
160 Ga0070671_100309514
161 JGI25151J46595_10001991
162 Ga0065712_10093472
163 Ga0070658_10159787
164 Ga0070670_100825694
165 Ga0068869_100027461
166 Ga0068869_100801858
167 Ga0070689_100316695
168 Ga0070671_100021325
169 Ga0070673_100174441
170 Ga0070688_100134184
171 Ga0070667_100009883
172 Ga0070705_100794778
173 Ga0070694_100983925
174 Ga0070698_100003024
175 Ga0070699_100001954
176 Ga0070699_100164794
177 Ga0070699_100453153
178 Ga0070697_101245828
179 Ga0070696_100039080
180 Ga0070696_100041819
181 Ga0070693_100906314
182 Ga0070704_100408928
183 Ga0070664_100184307
184 Ga0068854_100025705
185 Ga0068859_100104048
186 Ga0068859_100208451
187 Ga0068864_100172903
188 Ga0068864_100476451
189 Ga0068863_100396723
190 Ga0068858_100212984
191 Ga0068860_100023877
192 Ga0068862_100052836
193 Ga0075365_10006436
194 Ga0075364_10117540
195 Ga0075428_100124953
196 Ga0075428_100294000
197 Ga0075428_101042497
198 Ga0075430_100167768
199 Ga0075431_100091830
200 Ga0068865_100470168
201 Ga0097620_100104046
202 Ga0097620_100208454
203 Ga0105245_11097436
204 Ga0105247_10053104
205 Ga0114129_10043886
206 Ga0114129_10135893
207 Ga0105243_11449372
208 Ga0105242_10139219
209 Ga0105248_10000831
210 Ga0105248_10003374
211 Ga0105248_10936482
212 Ga0105238_10367385
213 Ga0105249_10091055
214 Ga0105249_11065643
215 Ga0105249_11448062
216 Ga0157378_10076458
217 Ga0163162_10006571
218 Ga0157375_10116635
219 Ga0163163_10002720
220 Ga0163163_10010970
221 Ga0157380_10774164
222 Ga0209025_1000673
223 Ga0207710_10014723
224 Ga0207705_10425908
225 Ga0207681_10105619
226 Ga0207659_10116258
227 Ga0207687_10729370
228 Ga0207644_10157009
229 Ga0207644_10244906
230 Ga0207670_10672864
231 Ga0207711_10036111
232 Ga0207689_10304119
233 Ga0207689_11025368
234 Ga0207651_10113248
235 Ga0207658_10093295
236 Ga0207676_10135789
237 Ga0207676_10543865
238 Ga0207675_102122041
239 Ga0268265_10146149
240 Ga0268265_12024984
241 Ga0265332_10001079
242 Ga0265325_10051669
243 Ga0265327_10002177
244 Ga0307513_10379723
245 Ga0307405_10226357
246 Ga0307413_11154316
247 Ga0307410_11305796
248 Ga0307414_10948079
249 Ga0307510_10145186
250 Ga0316582_0034960
251 Ga0439447_007656
252 Ga0466972_0321608
253 Ga0453684_0196391
254 Ga0495580_0281978
255 Ga0495582_0069178
256 Ga0495664_0433097
257 Ga0495663_0020745
258 Ga0495621_0397968
259 Ga0495668_0003096
260 Ga0496104_0554082
261 Ga0496104_0713731
262 Ga0496105_0544066
263 Ga0496108_0068509
264 Ga0496109_0145557
265 Ga0496112_0014831
266 Ga0496116_0001413
267 Ga0496117_0000289
268 Ga0496118_0188810
269 Ga0496122_0002303
270 Ga0496124_0165949
271 Ga0496126_0621566
272 Ga0501031_0005593
273 Ga0501033_0016324
274 Ga0501034_0422216
275 Ga0501036_0005831
276 Ga0501037_0073237
277 Ga0501038_0003218
278 Ga0501039_0008312
279 Ga0501040_0000631
280 Ga0501041_0000459
281 Ga0501042_0004651
282 Ga0501043_0006508
283 Ga0501046_0007522
284 Ga0501047_0830917
285 Ga0501048_0000457
286 Ga0501068_0027408
287 Ga0501069_0399135
288 Ga0501070_0021522
289 Ga0501071_0000456
290 Ga0501072_0001602
291 Ga0501072_0767482
292 Ga0501073_0046188
293 Ga0501074_0002370
294 Ga0501075_0589468
295 Ga0501077_0000456
296 Ga0501079_0000036
297 Ga0501080_0000401
298 Ga0501081_0000154
299 Ga0501083_0029962
300 Ga0501035_0077174
301 Ga0501044_0535776
302 Ga0501045_0000013
303 nmdc:mga0yw44_10420_c1
304 nmdc:mga05p37_7753_c1
305 nmdc:mga0qj67_198935_c1
306 nmdc:mga0qj67_52765_c1
307 nmdc:mga06r32_19568_c1
308 nmdc:mga06r32_82418_c1
309 Ga0501084_0000346
310 Ga0501084_0207767
311 Ga0501082_0003011
312 Ga0501082_0605942
313 Ga0530510_0012277
314 2691329723
315 2722728510
316 2757564887
317 2777836921
318 2919536414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13527

Acetyltransf_9

Acetyltransferase (GNAT) domain

34

156

0.89

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

72

155

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

33

154

0.8

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

44

158

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.9487 2 170
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.9135 1 169
4rs2-assembly1.cif.gz_A 1.55 angstrom crystal structure of gnat family n-acetyltransferase (yhbs) from escherichia coli in complex with coa 0.9063 2 170
4zbg-assembly1.cif.gz_A crystal structure of a gnat family acetyltransferase from brucella melitensis in complex with acetyl-coa 0.8906 1 169
6pau-assembly1.cif.gz_A structure of human nmt2 with myristoyl-lysine peptide and coa products 0.8619 2 115
ID Description Score Start End Superfamily
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9664 3 172 3.40.630.30
af_Q2G016_1_176_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9499 3 172 3.40.630.30
4rs2B00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9469 2 169 3.40.630.30
4zbgA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9135 1 169 3.40.630.30
af_P39368_4_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9105 1 164 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A329MTP8-F1-model_v4 GNAT family N-acetyltransferase 0.9973 1 172 GO:0016747
AF-A0A329MTP8-F1-model_v4 GNAT family N-acetyltransferase 0.9915 1 172 GO:0016747
AF-X1I5L6-F1-model_v4 N-acetyltransferase domain-containing protein 0.991 56 171 GO:0016747
AF-A0A2E3SQK2-F1-model_v4 GNAT family N-acetyltransferase 0.9905 2 172 GO:0016747
AF-A0A7K4HRK4-F1-model_v4 N-acetyltransferase 0.9897 1 172 GO:0016747

Map