F230890

General Info

Members Datasets Scaffolds Average Seq Length
158 126 316 240

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2818991472|2819741452
Length 280
Sequence SRGSAPRAGEPQQEQRPGPPPPVIQVRRLTKSYGHGDATVHALRGPSDPQTGEPLGVSLDIEQGDFVAVMGSSGSGKSTLMNILGCLDVPTAGRYLLDGIDVGHLDEQQLSLVRNRKIGFIFQSFNLVPRTTALAQVELPLAYAGVRAAERRQRAEAALSLVGLGSRMDHKPNELSGGQQQRVAVARALVTAPAMLLADEPTGNLDTRSTEEVLAIIDALNAAGRTVVLITHEDEVAAHAKRVLRLVDGQVISDKRQGPVVGPPPVLAAQQRSQLVGGPR

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
58 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
59 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
89 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
97 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
100 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
101 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
102 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
119 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
120 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
121 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
122 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
123 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
124 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
125 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
126 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.57
Metatranscriptomes 0
Isolates 4.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.27
Nodule 0
Rhizoplane 1.27
Rhizosphere 93.04
Stem 0
Stem Tuber 0
Unclassified 1.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10008506 3300001989 Bacteria 3832
2 JGI25407J50210_10002515 3300003373 Bacteria 4327
3 Ga0070690_100031307 3300005330 Bacteria 3313
4 Ga0070671_100195089 3300005355 Bacteria 1717
5 Ga0070671_100473128 3300005355 Bacteria 1076
6 Ga0070710_10000082 3300005437 Bacteria 43464
7 Ga0070705_100010911 3300005440 Bacteria 4563
8 Ga0070694_100183610 3300005444 Bacteria 1548
9 Ga0070694_100595384 3300005444 Bacteria 890
10 Ga0070708_100000028 3300005445 Bacteria 96912
11 Ga0070708_100003156 3300005445 Bacteria 12842
12 Ga0070708_100054531 3300005445 Bacteria 3551
13 Ga0070663_100503446 3300005455 Bacteria 1006
14 Ga0070681_10000437 3300005458 Bacteria 33911
15 Ga0070706_100005683 3300005467 Bacteria 11859
16 Ga0070706_100037995 3300005467 Bacteria 4445
17 Ga0070706_100092688 3300005467 Bacteria 2803
18 Ga0070707_100000062 3300005468 Bacteria 96912
19 Ga0070698_100003149 3300005471 Bacteria 18184
20 Ga0070698_100003305 3300005471 Bacteria 17739
21 Ga0070698_100021461 3300005471 Bacteria 6763
22 Ga0070698_100168773 3300005471 Bacteria 2130
23 Ga0070699_100000070 3300005518 Bacteria 96912
24 Ga0070679_100192314 3300005530 Bacteria 2009
25 Ga0070697_100107917 3300005536 Bacteria 2317
26 Ga0070695_100343071 3300005545 Bacteria 1117
27 Ga0070696_100013913 3300005546 Bacteria 5400
28 Ga0070704_100149856 3300005549 Bacteria 1832
29 Ga0070704_100279366 3300005549 Bacteria 1383
30 Ga0070664_100316403 3300005564 Bacteria 1413
31 Ga0068857_100462793 3300005577 Bacteria 1187
32 Ga0068856_100189263 3300005614 Bacteria 2072
33 Ga0068864_100034263 3300005618 Bacteria 4318
34 Ga0068858_100009217 3300005842 Bacteria 9427
35 Ga0068860_100092664 3300005843 Bacteria 2879
36 Ga0068862_100453180 3300005844 Bacteria 1210
37 Ga0081538_10000004 3300005981 Bacteria 194737
38 Ga0081539_10014651 3300005985 Bacteria 5774
39 Ga0070716_100101373 3300006173 Bacteria 1765
40 Ga0097621_100083805 3300006237 Bacteria 2657
41 Ga0097621_100178136 3300006237 Bacteria 1836
42 Ga0097621_100311935 3300006237 Bacteria 1391
43 Ga0068871_100030746 3300006358 Bacteria 4231
44 Ga0068871_100063234 3300006358 Bacteria 3026
45 Ga0075430_100002860 3300006846 Bacteria 14444
46 Ga0075431_100108268 3300006847 Bacteria 2868
47 Ga0075433_10192712 3300006852 Bacteria 1813
48 Ga0075433_10618614 3300006852 Bacteria 950
49 Ga0075429_100323977 3300006880 Unclassified 1348
50 Ga0111539_10369355 3300009094 Bacteria 1670
51 Ga0105243_10581972 3300009148 Bacteria 1075
52 Ga0105242_10009739 3300009176 Bacteria 7364
53 Ga0157374_10292098 3300013296 Bacteria 1611
54 Ga0157372_10189879 3300013307 Bacteria 2379
55 Ga0157375_10175145 3300013308 Bacteria 2294
56 Ga0163163_10000474 3300014325 Bacteria 36636
57 Ga0163163_10014105 3300014325 Bacteria 7338
58 Ga0157376_10033976 3300014969 Bacteria 4113
59 Ga0207692_10000087 3300025898 Bacteria 27051
60 Ga0207684_10000192 3300025910 Bacteria 96931
61 Ga0207684_10163058 3300025910 Bacteria 1920
62 Ga0207707_10001300 3300025912 Bacteria 23246
63 Ga0207693_10450484 3300025915 Bacteria 1006
64 Ga0207646_10000144 3300025922 Bacteria 96931
65 Ga0207664_10187640 3300025929 Bacteria 1778
66 Ga0207664_10478733 3300025929 Bacteria 1113
67 Ga0207664_10653708 3300025929 Bacteria 945
68 Ga0207644_10002890 3300025931 Bacteria 11069
69 Ga0207644_10015942 3300025931 Bacteria 5053
70 Ga0207668_10108852 3300025972 Bacteria 2075
71 Ga0207703_10036916 3300026035 Bacteria 3891
72 Ga0207641_10342845 3300026088 Bacteria 1422
73 Ga0207676_10104436 3300026095 Bacteria 2357
74 Ga0268264_10031478 3300028381 Bacteria 4349
75 Ga0265319_1015383 3300028563 Bacteria 2969
76 Ga0265319_1022429 3300028563 Bacteria 2301
77 Ga0265318_10021021 3300028577 Bacteria 2625
78 Ga0265318_10026376 3300028577 Bacteria 2288
79 Ga0265318_10070198 3300028577 Bacteria 1299
80 Ga0265322_10074047 3300028654 Bacteria 966
81 Ga0265338_10069504 3300028800 Bacteria 3025
82 Ga0265320_10020672 3300031240 Bacteria 3561
83 Ga0265331_10162151 3300031250 Bacteria 1013
84 Ga0265327_10004268 3300031251 Bacteria 12806
85 Ga0307513_10004958 3300031456 Bacteria 17650
86 Ga0307513_10270733 3300031456 Bacteria 1482
87 Ga0265314_10061627 3300031711 Bacteria 2553
88 Ga0265314_10096831 3300031711 Bacteria 1908
89 Ga0307405_10326149 3300031731 Bacteria 1175
90 Ga0307410_10554660 3300031852 Bacteria 953
91 Ga0307406_10096434 3300031901 Bacteria 2004
92 Ga0307409_100428221 3300031995 Bacteria 1271
93 Ga0373935_0171894 3300035692 Bacteria 1483
94 Ga0373937_0345608 3300036401 Bacteria 1409
95 Ga0373937_0391770 3300036401 Bacteria 1318
96 Ga0395900_0006732 3300037418 Bacteria 11923
97 Ga0395898_0012607 3300037466 Bacteria 8740
98 Ga0395905_0018547 3300037471 Bacteria 6604
99 Ga0395901_0027025 3300038443 Bacteria 5894
100 Ga0395901_1035076 3300038443 Bacteria 795
101 Ga0466972_0023107 3300044658 Bacteria 3093
102 Ga0466965_0006427 3300044683 Bacteria 5336
103 Ga0466965_0011905 3300044683 Bacteria 4083
104 Ga0466960_0016176 3300044901 Bacteria 3230
105 Ga0466960_0323073 3300044901 Bacteria 874
106 Ga0466959_0344678 3300045049 Bacteria 1016
107 Ga0466967_0466613 3300045976 Bacteria 1235
108 Ga0495603_0181909 3300046455 Bacteria 1216
109 Ga0495629_0070833 3300046459 Bacteria 2433
110 Ga0495639_0049427 3300046475 Bacteria 1909
111 Ga0495662_0075102 3300046476 Bacteria 1640
112 Ga0495618_0018317 3300046514 Bacteria 4300
113 Ga0495630_0221457 3300046517 Bacteria 1445
114 Ga0495652_0319987 3300046529 Bacteria 1121
115 Ga0495586_0116576 3300046535 Bacteria 1490
116 Ga0495586_0249193 3300046535 Bacteria 1013
117 Ga0495588_0012170 3300046674 Bacteria 4057
118 Ga0495623_0039817 3300046679 Bacteria 3002
119 Ga0495658_0023551 3300046683 Bacteria 3269
120 Ga0495658_0310099 3300046683 Bacteria 999
121 Ga0495613_0179741 3300046689 Bacteria 1498
122 Ga0495613_0513709 3300046689 Bacteria 805
123 Ga0495604_0033029 3300047317 Bacteria 4097
124 Ga0495674_0570110 3300047319 Bacteria 899
125 Ga0495672_0021315 3300047320 Bacteria 4228
126 Ga0495680_0312436 3300047322 Bacteria 1101
127 Ga0495675_0019163 3300047444 Bacteria 4347
128 Ga0495685_026833 3300047447 Bacteria 1981
129 Ga0496107_0378076 3300048910 Bacteria 1054
130 Ga0496115_0634708 3300048918 Bacteria 846
131 Ga0496121_0039407 3300048924 Bacteria 4165
132 Ga0501296_001605 3300049519 Bacteria 2297
133 Ga0501300_004130 3300049523 Bacteria 2158
134 Ga0501033_0004120 3300049570 Bacteria 11721
135 Ga0501047_0443817 3300049581 Bacteria 1127
136 Ga0501069_0007611 3300049585 Bacteria 5685
137 Ga0501073_0243690 3300049589 Bacteria 1241
138 Ga0501216_002938 3300049660 Bacteria 2457
139 Ga0501083_0276845 3300049744 Bacteria 1092
140 Ga0501044_0032029 3300049823 Bacteria 5527
141 Ga0501044_0529009 3300049823 Bacteria 1078
142 nmdc:mga0yw44_98733_c1 3300050492 Bacteria 1857
143 nmdc:mga09592_127958_c1 3300050508 Unclassified 2184
144 nmdc:mga0qj67_2041_c1 3300050509 Bacteria 14406
145 nmdc:mga06r32_42064_c1 3300050510 Bacteria 4343
146 nmdc:mga0n895_220960_c1 3300050512 Bacteria 1923
147 nmdc:mga0rr50_594346_c1 3300050513 Bacteria 943
148 nmdc:mga0a205_165081_c1 3300050515 Bacteria 2110
149 Ga0495601_0389239 3300053077 Bacteria 904
150 Ga0495655_0124714 3300053083 Bacteria 787
151 Ga0500566_0001466 3300053094 Bacteria 13814
152 2819741452 2818991472 Bacteria 10089953
153 2644018301 2643221601 Bacteria 7493239
154 2644174338 2643221631 Bacteria 8168043
155 2795794988 2795385472 Bacteria 6627535
156 2816426036 2816332119 Bacteria 8120218
157 2816511360 2816332139 Bacteria 9138787
158 2917741302 2917736166 Bacteria 9690793
159 JGI24739J22299_10008506
160 JGI25407J50210_10002515
161 Ga0070690_100031307
162 Ga0070671_100195089
163 Ga0070671_100473128
164 Ga0070710_10000082
165 Ga0070705_100010911
166 Ga0070694_100183610
167 Ga0070694_100595384
168 Ga0070708_100000028
169 Ga0070708_100003156
170 Ga0070708_100054531
171 Ga0070663_100503446
172 Ga0070681_10000437
173 Ga0070706_100005683
174 Ga0070706_100037995
175 Ga0070706_100092688
176 Ga0070707_100000062
177 Ga0070698_100003149
178 Ga0070698_100003305
179 Ga0070698_100021461
180 Ga0070698_100168773
181 Ga0070699_100000070
182 Ga0070679_100192314
183 Ga0070697_100107917
184 Ga0070695_100343071
185 Ga0070696_100013913
186 Ga0070704_100149856
187 Ga0070704_100279366
188 Ga0070664_100316403
189 Ga0068857_100462793
190 Ga0068856_100189263
191 Ga0068864_100034263
192 Ga0068858_100009217
193 Ga0068860_100092664
194 Ga0068862_100453180
195 Ga0081538_10000004
196 Ga0081539_10014651
197 Ga0070716_100101373
198 Ga0097621_100083805
199 Ga0097621_100178136
200 Ga0097621_100311935
201 Ga0068871_100030746
202 Ga0068871_100063234
203 Ga0075430_100002860
204 Ga0075431_100108268
205 Ga0075433_10192712
206 Ga0075433_10618614
207 Ga0075429_100323977
208 Ga0111539_10369355
209 Ga0105243_10581972
210 Ga0105242_10009739
211 Ga0157374_10292098
212 Ga0157372_10189879
213 Ga0157375_10175145
214 Ga0163163_10000474
215 Ga0163163_10014105
216 Ga0157376_10033976
217 Ga0207692_10000087
218 Ga0207684_10000192
219 Ga0207684_10163058
220 Ga0207707_10001300
221 Ga0207693_10450484
222 Ga0207646_10000144
223 Ga0207664_10187640
224 Ga0207664_10478733
225 Ga0207664_10653708
226 Ga0207644_10002890
227 Ga0207644_10015942
228 Ga0207668_10108852
229 Ga0207703_10036916
230 Ga0207641_10342845
231 Ga0207676_10104436
232 Ga0268264_10031478
233 Ga0265319_1015383
234 Ga0265319_1022429
235 Ga0265318_10021021
236 Ga0265318_10026376
237 Ga0265318_10070198
238 Ga0265322_10074047
239 Ga0265338_10069504
240 Ga0265320_10020672
241 Ga0265331_10162151
242 Ga0265327_10004268
243 Ga0307513_10004958
244 Ga0307513_10270733
245 Ga0265314_10061627
246 Ga0265314_10096831
247 Ga0307405_10326149
248 Ga0307410_10554660
249 Ga0307406_10096434
250 Ga0307409_100428221
251 Ga0373935_0171894
252 Ga0373937_0345608
253 Ga0373937_0391770
254 Ga0395900_0006732
255 Ga0395898_0012607
256 Ga0395905_0018547
257 Ga0395901_0027025
258 Ga0395901_1035076
259 Ga0466972_0023107
260 Ga0466965_0006427
261 Ga0466965_0011905
262 Ga0466960_0016176
263 Ga0466960_0323073
264 Ga0466959_0344678
265 Ga0466967_0466613
266 Ga0495603_0181909
267 Ga0495629_0070833
268 Ga0495639_0049427
269 Ga0495662_0075102
270 Ga0495618_0018317
271 Ga0495630_0221457
272 Ga0495652_0319987
273 Ga0495586_0116576
274 Ga0495586_0249193
275 Ga0495588_0012170
276 Ga0495623_0039817
277 Ga0495658_0023551
278 Ga0495658_0310099
279 Ga0495613_0179741
280 Ga0495613_0513709
281 Ga0495604_0033029
282 Ga0495674_0570110
283 Ga0495672_0021315
284 Ga0495680_0312436
285 Ga0495675_0019163
286 Ga0495685_026833
287 Ga0496107_0378076
288 Ga0496115_0634708
289 Ga0496121_0039407
290 Ga0501296_001605
291 Ga0501300_004130
292 Ga0501033_0004120
293 Ga0501047_0443817
294 Ga0501069_0007611
295 Ga0501073_0243690
296 Ga0501216_002938
297 Ga0501083_0276845
298 Ga0501044_0032029
299 Ga0501044_0529009
300 nmdc:mga0yw44_98733_c1
301 nmdc:mga09592_127958_c1
302 nmdc:mga0qj67_2041_c1
303 nmdc:mga06r32_42064_c1
304 nmdc:mga0n895_220960_c1
305 nmdc:mga0rr50_594346_c1
306 nmdc:mga0a205_165081_c1
307 Ga0495601_0389239
308 Ga0495655_0124714
309 Ga0500566_0001466
310 2819741452
311 2644018301
312 2644174338
313 2795794988
314 2816426036
315 2816511360
316 2917741302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

55

203

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9739 5 230
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9717 5 227
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9674 7 230
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9658 6 230
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9635 5 229
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9717 5 227 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9707 6 228 3.40.50.300
af_P75957_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9641 3 223 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9584 33 229 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9581 4 229 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1F9YAP7-F1-model_v4 ABC transporter ATP-binding protein 0.982 3 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2G1UQ51-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9777 1 228 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1H5S202-F1-model_v4 deleted 0.9773 6 228
AF-A0A7V4MYJ4-F1-model_v4 ABC transporter ATP-binding protein 0.9748 4 228 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7H4ZMJ9-F1-model_v4 deleted 0.9744 1 230

Map