F230457

General Info

Members Datasets Scaffolds Average Seq Length
158 120 316 148

Family's Representative Sequence

Representative Sequence 3300046528|Ga0495642_0121523|Ga0495642_0121523_310_762
Length 139
Sequence MENNKIVDPQVDNATKQVIYTGKTHTIGGREGGSSRSSDGRLDVQLTFPGTPGEGTNPEQLFAAGWSACFFSAMKIVAGQMKVRFPADASIAYFLSGRLNVSLPGLDREVVRAIADAAHQICPYSKATRGNVDVEINLV

Samples

Sample ID Description Type Environment
1 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
82 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
103 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 96.2
Stem 0
Stem Tuber 0
Unclassified 17.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495642_0121523 3300046528 Bacteria 1121
2 rootH1_10279509 3300003323 Unclassified 1066
3 Ga0065707_10105910 3300005295 Bacteria 2623
4 Ga0065707_10252726 3300005295 Bacteria 1120
5 Ga0070666_10013632 3300005335 Bacteria 5162
6 Ga0070689_100013111 3300005340 Bacteria 5991
7 Ga0070689_100298788 3300005340 Bacteria 1340
8 Ga0070689_100444810 3300005340 Bacteria 1102
9 Ga0070688_100160999 3300005365 Unclassified 1542
10 Ga0070688_100347255 3300005365 Bacteria 1085
11 Ga0070709_10949014 3300005434 Bacteria 682
12 Ga0070708_100015461 3300005445 Bacteria 6305
13 Ga0070708_100038066 3300005445 Bacteria 4200
14 Ga0070708_100049792 3300005445 Bacteria 3707
15 Ga0070708_100665709 3300005445 Bacteria 980
16 Ga0070706_100743992 3300005467 Bacteria 908
17 Ga0070698_100496631 3300005471 Unclassified 1158
18 Ga0070697_100289912 3300005536 Bacteria 1405
19 Ga0070686_100275679 3300005544 Bacteria 1238
20 Ga0070695_100331490 3300005545 Bacteria 1134
21 Ga0070696_101669141 3300005546 Bacteria 549
22 Ga0070704_100743526 3300005549 Bacteria 873
23 Ga0068857_100166939 3300005577 Bacteria 1999
24 Ga0068857_100710069 3300005577 Bacteria 956
25 Ga0070702_100637372 3300005615 Bacteria 804
26 Ga0068859_100915562 3300005617 Bacteria 961
27 Ga0068864_100282462 3300005618 Bacteria 1550
28 Ga0068858_100611183 3300005842 Bacteria 1058
29 Ga0068858_100625972 3300005842 Bacteria 1045
30 Ga0068860_100303104 3300005843 Bacteria 1565
31 Ga0068862_100862011 3300005844 Bacteria 888
32 Ga0070716_100305805 3300006173 Unclassified 1108
33 Ga0075430_101651228 3300006846 Bacteria 526
34 Ga0097620_100915323 3300006931 Bacteria 961
35 Ga0075435_100609206 3300007076 Unclassified 947
36 Ga0099795_10106672 3300007788 Bacteria 1105
37 Ga0105240_10000136 3300009093 Bacteria 150544
38 Ga0105240_10202680 3300009093 Unclassified 2324
39 Ga0111539_10235675 3300009094 Bacteria 2131
40 Ga0111539_11050512 3300009094 Bacteria 947
41 Ga0111539_11952517 3300009094 Unclassified 681
42 Ga0114129_10382514 3300009147 Bacteria 1858
43 Ga0105242_10025951 3300009176 Bacteria 4641
44 Ga0105242_10581471 3300009176 Bacteria 1079
45 Ga0105242_11198214 3300009176 Bacteria 778
46 Ga0105248_10260419 3300009177 Bacteria 1952
47 Ga0105248_11696135 3300009177 Unclassified 716
48 Ga0105237_10081752 3300009545 Bacteria 3221
49 Ga0105238_11266769 3300009551 Bacteria 763
50 Ga0105249_12158143 3300009553 Unclassified 630
51 Ga0105239_10099366 3300010375 Bacteria 3217
52 Ga0105239_10307395 3300010375 Bacteria 1786
53 Ga0157374_10033519 3300013296 Bacteria 4685
54 Ga0157374_10326752 3300013296 Unclassified 1521
55 Ga0157378_11408672 3300013297 Bacteria 740
56 Ga0163162_11842951 3300013306 Bacteria 692
57 Ga0157375_10000094 3300013308 Bacteria 88991
58 Ga0157375_11239888 3300013308 Unclassified 875
59 Ga0163163_10000293 3300014325 Bacteria 49814
60 Ga0163163_10059685 3300014325 Bacteria 3774
61 Ga0163163_11686061 3300014325 Bacteria 694
62 Ga0157380_10364734 3300014326 Bacteria 1357
63 Ga0157377_10889469 3300014745 Bacteria 665
64 Ga0157376_12082032 3300014969 Bacteria 606
65 Ga0213876_10051255 3300021384 Bacteria 2181
66 Ga0207680_10007969 3300025903 Bacteria 5182
67 Ga0207645_10218676 3300025907 Bacteria 1255
68 Ga0207695_10000226 3300025913 Bacteria 150570
69 Ga0207695_10815308 3300025913 Bacteria 813
70 Ga0207670_10025023 3300025936 Bacteria 3740
71 Ga0207670_10033769 3300025936 Unclassified 3300
72 Ga0207670_10649167 3300025936 Bacteria 870
73 Ga0207665_10075622 3300025939 Bacteria 2307
74 Ga0207711_10139642 3300025941 Bacteria 2179
75 Ga0207679_11290645 3300025945 Bacteria 670
76 Ga0207708_10141273 3300026075 Bacteria 1889
77 Ga0207708_10191161 3300026075 Bacteria 1629
78 Ga0207676_10105753 3300026095 Bacteria 2344
79 Ga0207674_10063602 3300026116 Bacteria 3724
80 Ga0207674_10180419 3300026116 Bacteria 2063
81 Ga0207683_11192672 3300026121 Unclassified 706
82 Ga0268265_10503434 3300028380 Bacteria 1142
83 Ga0268264_10362071 3300028381 Bacteria 1384
84 Ga0265318_10183148 3300028577 Unclassified 767
85 Ga0265338_10006949 3300028800 Bacteria 14232
86 Ga0265320_10000058 3300031240 Bacteria 102441
87 Ga0265339_10002141 3300031249 Bacteria 14376
88 Ga0265316_10446084 3300031344 Bacteria 928
89 Ga0307513_10550670 3300031456 Bacteria 866
90 Ga0265314_10064643 3300031711 Bacteria 2476
91 Ga0373940_0194997 3300035088 Unclassified 664
92 Ga0373923_0397682 3300035111 Unclassified 663
93 Ga0373953_0149905 3300035117 Bacteria 1000
94 Ga0373954_0014360 3300035118 Bacteria 3532
95 Ga0373956_0408404 3300035119 Bacteria 648
96 Ga0373943_0923789 3300035170 Bacteria 522
97 Ga0373935_0642489 3300035692 Bacteria 778
98 Ga0373927_0728601 3300035695 Bacteria 655
99 Ga0373947_0429114 3300035725 Bacteria 894
100 Ga0373937_0181082 3300036401 Unclassified 1979
101 Ga0373937_0287786 3300036401 Unclassified 1552
102 Ga0373925_1200828 3300037068 Bacteria 623
103 Ga0436365_1718986 3300039437 Bacteria 2719
104 Ga0436362_0722205 3300039453 Bacteria 643
105 Ga0453684_1930218 3300044712 Bacteria 597
106 Ga0451576_0263496 3300045051 Bacteria 1802
107 Ga0451576_1587804 3300045051 Unclassified 679
108 Ga0495603_0482669 3300046455 Bacteria 710
109 Ga0495641_0012877 3300046461 Bacteria 4641
110 Ga0495662_0062614 3300046476 Bacteria 1797
111 Ga0495628_0083404 3300046516 Bacteria 2482
112 Ga0495630_0126754 3300046517 Bacteria 1938
113 Ga0495630_0257912 3300046517 Bacteria 1332
114 Ga0495630_0385404 3300046517 Bacteria 1074
115 Ga0495630_0494273 3300046517 Bacteria 938
116 Ga0495644_0008528 3300046523 Bacteria 3948
117 Ga0495666_0291877 3300046526 Unclassified 738
118 Ga0495666_0324607 3300046526 Bacteria 695
119 Ga0495652_0527427 3300046529 Unclassified 815
120 Ga0495586_0088595 3300046535 Bacteria 1707
121 Ga0495586_0624254 3300046535 Unclassified 623
122 Ga0495645_0065621 3300046543 Bacteria 2626
123 Ga0495645_0224683 3300046543 Bacteria 1261
124 Ga0495645_0507733 3300046543 Bacteria 753
125 Ga0495634_0201923 3300046642 Bacteria 1234
126 Ga0495599_0629490 3300046678 Bacteria 623
127 Ga0495646_0639163 3300046680 Unclassified 538
128 Ga0495658_0020822 3300046683 Bacteria 3449
129 Ga0495613_0242343 3300046689 Bacteria 1260
130 Ga0495613_0367663 3300046689 Unclassified 985
131 Ga0495624_0165459 3300046690 Bacteria 1350
132 Ga0495624_0374811 3300046690 Bacteria 855
133 Ga0495674_0822898 3300047319 Bacteria 721
134 Ga0495674_1082546 3300047319 Bacteria 611
135 Ga0495676_0096801 3300047321 Bacteria 2193
136 Ga0495680_0548003 3300047322 Bacteria 780
137 Ga0495675_0192347 3300047444 Bacteria 1245
138 Ga0495684_0482026 3300047471 Unclassified 856
139 Ga0496122_0013403 3300048925 Bacteria 8028
140 Ga0496123_0011515 3300048926 Bacteria 7662
141 Ga0501031_0000107 3300049568 Bacteria 44533
142 Ga0501032_0460654 3300049569 Unclassified 814
143 Ga0501036_0039154 3300049572 Bacteria 4014
144 Ga0501037_0000150 3300049573 Bacteria 65079
145 Ga0501039_0006199 3300049575 Bacteria 9077
146 Ga0501043_0000488 3300049579 Bacteria 35521
147 Ga0501047_0001836 3300049581 Bacteria 20500
148 Ga0501070_0123508 3300049586 Bacteria 2139
149 Ga0501073_0171048 3300049589 Bacteria 1504
150 Ga0501035_0000002 3300049822 Bacteria 585447
151 Ga0501044_0000805 3300049823 Bacteria 37775
152 nmdc:mga08y16_1227977_c1 3300050511 Bacteria 719
153 nmdc:mga08y16_212516_c1 3300050511 Bacteria 2003
154 nmdc:mga0n895_890590_c1 3300050512 Unclassified 876
155 nmdc:mga0rr50_551059_c1 3300050513 Unclassified 982
156 nmdc:mga0a205_638284_c1 3300050515 Bacteria 916
157 Ga0495601_0128259 3300053077 Bacteria 1651
158 Ga0530510_0517241 3300061734 Bacteria 905
159 Ga0495642_0121523
160 rootH1_10279509
161 Ga0065707_10105910
162 Ga0065707_10252726
163 Ga0070666_10013632
164 Ga0070689_100013111
165 Ga0070689_100298788
166 Ga0070689_100444810
167 Ga0070688_100160999
168 Ga0070688_100347255
169 Ga0070709_10949014
170 Ga0070708_100015461
171 Ga0070708_100038066
172 Ga0070708_100049792
173 Ga0070708_100665709
174 Ga0070706_100743992
175 Ga0070698_100496631
176 Ga0070697_100289912
177 Ga0070686_100275679
178 Ga0070695_100331490
179 Ga0070696_101669141
180 Ga0070704_100743526
181 Ga0068857_100166939
182 Ga0068857_100710069
183 Ga0070702_100637372
184 Ga0068859_100915562
185 Ga0068864_100282462
186 Ga0068858_100611183
187 Ga0068858_100625972
188 Ga0068860_100303104
189 Ga0068862_100862011
190 Ga0070716_100305805
191 Ga0075430_101651228
192 Ga0097620_100915323
193 Ga0075435_100609206
194 Ga0099795_10106672
195 Ga0105240_10000136
196 Ga0105240_10202680
197 Ga0111539_10235675
198 Ga0111539_11050512
199 Ga0111539_11952517
200 Ga0114129_10382514
201 Ga0105242_10025951
202 Ga0105242_10581471
203 Ga0105242_11198214
204 Ga0105248_10260419
205 Ga0105248_11696135
206 Ga0105237_10081752
207 Ga0105238_11266769
208 Ga0105249_12158143
209 Ga0105239_10099366
210 Ga0105239_10307395
211 Ga0157374_10033519
212 Ga0157374_10326752
213 Ga0157378_11408672
214 Ga0163162_11842951
215 Ga0157375_10000094
216 Ga0157375_11239888
217 Ga0163163_10000293
218 Ga0163163_10059685
219 Ga0163163_11686061
220 Ga0157380_10364734
221 Ga0157377_10889469
222 Ga0157376_12082032
223 Ga0213876_10051255
224 Ga0207680_10007969
225 Ga0207645_10218676
226 Ga0207695_10000226
227 Ga0207695_10815308
228 Ga0207670_10025023
229 Ga0207670_10033769
230 Ga0207670_10649167
231 Ga0207665_10075622
232 Ga0207711_10139642
233 Ga0207679_11290645
234 Ga0207708_10141273
235 Ga0207708_10191161
236 Ga0207676_10105753
237 Ga0207674_10063602
238 Ga0207674_10180419
239 Ga0207683_11192672
240 Ga0268265_10503434
241 Ga0268264_10362071
242 Ga0265318_10183148
243 Ga0265338_10006949
244 Ga0265320_10000058
245 Ga0265339_10002141
246 Ga0265316_10446084
247 Ga0307513_10550670
248 Ga0265314_10064643
249 Ga0373940_0194997
250 Ga0373923_0397682
251 Ga0373953_0149905
252 Ga0373954_0014360
253 Ga0373956_0408404
254 Ga0373943_0923789
255 Ga0373935_0642489
256 Ga0373927_0728601
257 Ga0373947_0429114
258 Ga0373937_0181082
259 Ga0373937_0287786
260 Ga0373925_1200828
261 Ga0436365_1718986
262 Ga0436362_0722205
263 Ga0453684_1930218
264 Ga0451576_0263496
265 Ga0451576_1587804
266 Ga0495603_0482669
267 Ga0495641_0012877
268 Ga0495662_0062614
269 Ga0495628_0083404
270 Ga0495630_0126754
271 Ga0495630_0257912
272 Ga0495630_0385404
273 Ga0495630_0494273
274 Ga0495644_0008528
275 Ga0495666_0291877
276 Ga0495666_0324607
277 Ga0495652_0527427
278 Ga0495586_0088595
279 Ga0495586_0624254
280 Ga0495645_0065621
281 Ga0495645_0224683
282 Ga0495645_0507733
283 Ga0495634_0201923
284 Ga0495599_0629490
285 Ga0495646_0639163
286 Ga0495658_0020822
287 Ga0495613_0242343
288 Ga0495613_0367663
289 Ga0495624_0165459
290 Ga0495624_0374811
291 Ga0495674_0822898
292 Ga0495674_1082546
293 Ga0495676_0096801
294 Ga0495680_0548003
295 Ga0495675_0192347
296 Ga0495684_0482026
297 Ga0496122_0013403
298 Ga0496123_0011515
299 Ga0501031_0000107
300 Ga0501032_0460654
301 Ga0501036_0039154
302 Ga0501037_0000150
303 Ga0501039_0006199
304 Ga0501043_0000488
305 Ga0501047_0001836
306 Ga0501070_0123508
307 Ga0501073_0171048
308 Ga0501035_0000002
309 Ga0501044_0000805
310 nmdc:mga08y16_1227977_c1
311 nmdc:mga08y16_212516_c1
312 nmdc:mga0n895_890590_c1
313 nmdc:mga0rr50_551059_c1
314 nmdc:mga0a205_638284_c1
315 Ga0495601_0128259
316 Ga0530510_0517241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

51

137

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mh4-assembly1.cif.gz_B crystal structure of osmc-like protein from burkholderia cenocepacia j2315 0.9531 17 150
1zb9-assembly1.cif.gz_B crystal structure of xylella fastidiosa organic peroxide resistance protein 0.9469 17 150
6ed0-assembly1.cif.gz_B "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.9314 15 150
2bjo-assembly1.cif.gz_B crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis 0.9302 18 150
6ed0-assembly1.cif.gz_A "ohra (organic hydroperoxide resistance protein) mutant (c61s) in the ""open conformation"" from chromobacterium violaceum" 0.928 15 150
ID Description Score Start End Superfamily
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9463 57 150 3.30.300.20
4xx2A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9366 57 150 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9356 57 150 3.30.300.20
af_Q2G1T3_42_139_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9226 57 150 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9079 57 150 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A848HNV6-F1-model_v4 Ohr family peroxiredoxin 0.977 59 150 GO:0006979
AF-A0A6J5EA45-F1-model_v4 Organic hydroperoxide resistance protein OhrB 0.9716 89 150 GO:0006979
AF-A0A508X706-F1-model_v4 Organic hydroperoxide resistance protein 0.9669 51 150 GO:0006979
AF-A0A2M8ZG83-F1-model_v4 deleted 0.9669 59 150
AF-A0A3D4MDN2-F1-model_v4 Organic hydroperoxide resistance protein 0.9663 16 149 GO:0006979

Map