F230283
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 158 | 92 | 316 | 272 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0114806|Ga0451577_0114806_951_1841 |
| Length | 296 |
| Sequence | MQKCSTQNTIFVQEKNNTIMNAVQLFEEIRKKRSFLCIGLDTDIQKIPRHLMDTTDPIFTFNKEIIDHTHDLAVAYKPNLAFYESLGAEGWVSLDKTVKYIREKYPELFIIADAKRGDIGNTSSLYARAFFDHFDFDAVTVAPYMGEDSVKPFMTYIDKWVIVLALTSNKGAFDFQFLKDEKSGDLLFESVLKTSKTWGTTDNMMYVVGATKAEKLEEIRQIVPDHFLLVPGVGAQGGSLQEVAGYGMNSQCGLLVNSSRAIIYASDGEDFAQLARQEAENVQLEMEELLLEAELL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 12 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 13 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 14 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 15 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 16 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 17 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 18 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 20 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 21 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 22 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 23 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 24 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 27 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 28 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 34 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 35 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 36 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 37 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 38 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 39 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 40 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 41 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 42 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 43 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 44 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 45 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 46 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 47 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 48 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 49 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 50 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 51 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 52 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 53 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 54 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 55 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 56 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 57 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 58 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 59 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 60 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 61 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 62 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 63 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 64 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 65 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 66 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 67 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 68 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 69 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 77 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 78 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 79 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 80 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 81 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 82 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 83 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 84 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 85 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 86 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 87 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 88 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 89 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 90 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 91 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 92 | 2958512119 | Flavobacterium sp. Sd200 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.1 |
| Metatranscriptomes | 0.63 |
| Isolates | 1.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.86 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 72.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.86 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451577_0114806 | 3300042876 | Bacteria | 2411 |
| 2 | rootH1_10005066 | 3300003316 | Bacteria | 17676 |
| 3 | rootH1_10040569 | 3300003316 | Bacteria | 1314 |
| 4 | rootH2_10021704 | 3300003320 | Bacteria | 49464 |
| 5 | rootH2_10029861 | 3300003320 | Bacteria | 3099 |
| 6 | rootH2_10219748 | 3300003320 | Bacteria | 2486 |
| 7 | rootL2_10004418 | 3300003322 | Bacteria | 2780 |
| 8 | rootL2_10004419 | 3300003322 | Bacteria | 2371 |
| 9 | rootL2_10033074 | 3300003322 | Bacteria | 1683 |
| 10 | rootL2_10072791 | 3300003322 | Bacteria | 6593 |
| 11 | rootL2_10103343 | 3300003322 | Bacteria | 7358 |
| 12 | rootL2_10108482 | 3300003322 | Bacteria | 3472 |
| 13 | rootH1_10007162 | 3300003323 | Bacteria | 4311 |
| 14 | rootH1_10015499 | 3300003323 | Bacteria | 86587 |
| 15 | rootH1_10107066 | 3300003323 | Bacteria | 9463 |
| 16 | rootH1_10147679 | 3300003323 | Bacteria | 2687 |
| 17 | rootH1_10193617 | 3300003323 | Bacteria | 2018 |
| 18 | Ga0055531_10000148 | 3300003794 | Bacteria | 80963 |
| 19 | Ga0065165_1001087 | 3300005262 | Bacteria | 32424 |
| 20 | Ga0065715_10005180 | 3300005293 | Bacteria | 3725 |
| 21 | Ga0070713_100266073 | 3300005436 | Bacteria | 1568 |
| 22 | Ga0070672_100064962 | 3300005543 | Bacteria | 2885 |
| 23 | Ga0068855_100668838 | 3300005563 | Bacteria | 1114 |
| 24 | Ga0068856_100013929 | 3300005614 | Bacteria | 7778 |
| 25 | Ga0068856_100032243 | 3300005614 | Bacteria | 5129 |
| 26 | Ga0068852_100337813 | 3300005616 | Bacteria | 1467 |
| 27 | Ga0068864_100232930 | 3300005618 | Unclassified | 1704 |
| 28 | Ga0068864_100475319 | 3300005618 | Bacteria | 1199 |
| 29 | Ga0068862_100055145 | 3300005844 | Bacteria | 3404 |
| 30 | Ga0068862_100081738 | 3300005844 | Bacteria | 2803 |
| 31 | Ga0075428_100036093 | 3300006844 | Bacteria | 5448 |
| 32 | Ga0111539_10021088 | 3300009094 | Bacteria | 8023 |
| 33 | Ga0111539_10060119 | 3300009094 | Bacteria | 4504 |
| 34 | Ga0105242_10044708 | 3300009176 | Unclassified | 3587 |
| 35 | Ga0157370_10580050 | 3300013104 | Unclassified | 1027 |
| 36 | Ga0163162_10059803 | 3300013306 | Bacteria | 3843 |
| 37 | Ga0157372_10123471 | 3300013307 | Unclassified | 2976 |
| 38 | Ga0157375_10009601 | 3300013308 | Bacteria | 8500 |
| 39 | Ga0163163_10120400 | 3300014325 | Bacteria | 2658 |
| 40 | Ga0157380_10000001 | 3300014326 | Bacteria | 254890 |
| 41 | Ga0157380_10057802 | 3300014326 | Bacteria | 3090 |
| 42 | Ga0157376_10050030 | 3300014969 | Bacteria | 3465 |
| 43 | Ga0209050_1001692 | 3300025298 | Bacteria | 22112 |
| 44 | Ga0209050_1012594 | 3300025298 | Bacteria | 3859 |
| 45 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 46 | Ga0207700_10109734 | 3300025928 | Bacteria | 2218 |
| 47 | Ga0207665_10081561 | 3300025939 | Bacteria | 2227 |
| 48 | Ga0207702_10010426 | 3300026078 | Bacteria | 7779 |
| 49 | Ga0207676_10239034 | 3300026095 | Bacteria | 1628 |
| 50 | Ga0207698_10313063 | 3300026142 | Bacteria | 1467 |
| 51 | Ga0307515_10000009 | 3300028794 | Bacteria | 653206 |
| 52 | Ga0307515_10111889 | 3300028794 | Bacteria | 3180 |
| 53 | Ga0307515_10184433 | 3300028794 | Bacteria | 2022 |
| 54 | Ga0265338_10005892 | 3300028800 | Bacteria | 15808 |
| 55 | Ga0265327_10008439 | 3300031251 | Bacteria | 7667 |
| 56 | Ga0265327_10044677 | 3300031251 | Unclassified | 2360 |
| 57 | Ga0265316_10015931 | 3300031344 | Bacteria | 6544 |
| 58 | Ga0307513_10071802 | 3300031456 | Bacteria | 3611 |
| 59 | Ga0307509_10082892 | 3300031507 | Bacteria | 3307 |
| 60 | Ga0307509_10129623 | 3300031507 | Bacteria | 2481 |
| 61 | Ga0307408_100050821 | 3300031548 | Bacteria | 2983 |
| 62 | Ga0307408_100062654 | 3300031548 | Bacteria | 2718 |
| 63 | Ga0307514_10047172 | 3300031649 | Bacteria | 3364 |
| 64 | Ga0316579_10135332 | 3300031691 | Bacteria | 1187 |
| 65 | Ga0316576_10022607 | 3300031727 | Bacteria | 4369 |
| 66 | Ga0316576_10041706 | 3300031727 | Bacteria | 3306 |
| 67 | Ga0316576_10105531 | 3300031727 | Bacteria | 2109 |
| 68 | Ga0316576_10449391 | 3300031727 | Bacteria | 952 |
| 69 | Ga0316578_10016023 | 3300031728 | Bacteria | 4047 |
| 70 | Ga0316578_10073864 | 3300031728 | Bacteria | 2021 |
| 71 | Ga0307405_10308962 | 3300031731 | Bacteria | 1203 |
| 72 | Ga0316577_10015902 | 3300031733 | Bacteria | 4142 |
| 73 | Ga0307413_10028114 | 3300031824 | Bacteria | 3126 |
| 74 | Ga0307412_10336190 | 3300031911 | Bacteria | 1207 |
| 75 | Ga0307416_100037405 | 3300032002 | Bacteria | 3734 |
| 76 | Ga0307414_10000088 | 3300032004 | Bacteria | 84711 |
| 77 | Ga0307414_10001268 | 3300032004 | Bacteria | 13016 |
| 78 | Ga0307414_10012303 | 3300032004 | Bacteria | 5053 |
| 79 | Ga0307414_10015584 | 3300032004 | Bacteria | 4590 |
| 80 | Ga0307414_10020518 | 3300032004 | Bacteria | 4121 |
| 81 | Ga0307414_10328510 | 3300032004 | Bacteria | 1304 |
| 82 | Ga0307414_10728829 | 3300032004 | Bacteria | 900 |
| 83 | Ga0316585_10050118 | 3300032137 | Bacteria | 1340 |
| 84 | Ga0316596_1053287 | 3300033541 | Bacteria | 1073 |
| 85 | Ga0316574_0002637 | 3300035398 | Bacteria | 9050 |
| 86 | Ga0373927_0015002 | 3300035695 | Bacteria | 5126 |
| 87 | Ga0373937_0355544 | 3300036401 | Bacteria | 1388 |
| 88 | Ga0316582_0307184 | 3300036647 | Unclassified | 1090 |
| 89 | Ga0316584_0006573 | 3300036712 | Bacteria | 7875 |
| 90 | Ga0316584_0019711 | 3300036712 | Bacteria | 4877 |
| 91 | Ga0395899_0000061 | 3300037312 | Bacteria | 212002 |
| 92 | Ga0395900_0250682 | 3300037418 | Unclassified | 1772 |
| 93 | Ga0395905_0000208 | 3300037471 | Bacteria | 91236 |
| 94 | Ga0395901_0001271 | 3300038443 | Bacteria | 26750 |
| 95 | Ga0400485_18269 | 3300038735 | Bacteria | 31127 |
| 96 | Ga0400486_19949 | 3300038742 | Bacteria | 17433 |
| 97 | Ga0400486_22976 | 3300038742 | Bacteria | 93315 |
| 98 | Ga0400483_015018 | 3300039062 | Bacteria | 97237 |
| 99 | Ga0400489_61526 | 3300039093 | Bacteria | 22718 |
| 100 | Ga0400487_21303 | 3300039110 | Bacteria | 74949 |
| 101 | Ga0400487_61490 | 3300039110 | Bacteria | 4487 |
| 102 | Ga0451577_0034061 | 3300042876 | Bacteria | 4593 |
| 103 | Ga0451577_0048565 | 3300042876 | Bacteria | 3791 |
| 104 | Ga0451577_0050522 | 3300042876 | Unclassified | 3712 |
| 105 | Ga0451577_0062985 | 3300042876 | Bacteria | 3307 |
| 106 | Ga0451577_0110681 | 3300042876 | Bacteria | 2457 |
| 107 | Ga0453683_0000078 | 3300044673 | Bacteria | 147056 |
| 108 | Ga0453683_0027827 | 3300044673 | Bacteria | 3582 |
| 109 | Ga0453683_0050899 | 3300044673 | Bacteria | 2595 |
| 110 | Ga0453683_0123196 | 3300044673 | Bacteria | 1632 |
| 111 | Ga0453683_0145018 | 3300044673 | Bacteria | 1499 |
| 112 | Ga0453684_0000161 | 3300044712 | Bacteria | 298175 |
| 113 | Ga0453684_0000311 | 3300044712 | Bacteria | 206847 |
| 114 | Ga0453684_0000547 | 3300044712 | Bacteria | 142253 |
| 115 | Ga0453684_0001960 | 3300044712 | Bacteria | 53054 |
| 116 | Ga0453684_0002363 | 3300044712 | Bacteria | 46117 |
| 117 | Ga0453684_0005524 | 3300044712 | Bacteria | 24951 |
| 118 | Ga0453684_0011057 | 3300044712 | Bacteria | 15244 |
| 119 | Ga0453684_0011552 | 3300044712 | Bacteria | 14771 |
| 120 | Ga0453684_0013912 | 3300044712 | Bacteria | 12979 |
| 121 | Ga0453684_0016040 | 3300044712 | Bacteria | 11761 |
| 122 | Ga0453684_0099612 | 3300044712 | Bacteria | 3559 |
| 123 | Ga0453684_0111363 | 3300044712 | Bacteria | 3325 |
| 124 | Ga0453684_0262298 | 3300044712 | Bacteria | 1978 |
| 125 | Ga0451576_0000059 | 3300045051 | Bacteria | 296795 |
| 126 | Ga0451576_0003315 | 3300045051 | Bacteria | 22330 |
| 127 | Ga0451576_0003859 | 3300045051 | Bacteria | 20105 |
| 128 | Ga0451576_0017598 | 3300045051 | Bacteria | 7854 |
| 129 | Ga0451576_0519837 | 3300045051 | Bacteria | 1250 |
| 130 | Ga0451576_0607666 | 3300045051 | Unclassified | 1149 |
| 131 | Ga0495592_0166267 | 3300046454 | Bacteria | 1514 |
| 132 | Ga0495638_0000197 | 3300046460 | Bacteria | 86853 |
| 133 | Ga0495634_0025778 | 3300046642 | Bacteria | 4107 |
| 134 | Ga0495625_0006982 | 3300046660 | Bacteria | 9954 |
| 135 | Ga0495599_0194703 | 3300046678 | Unclassified | 1246 |
| 136 | Ga0495670_0020906 | 3300046691 | Bacteria | 3227 |
| 137 | Ga0495581_0110975 | 3300047315 | Unclassified | 1595 |
| 138 | Ga0501300_001673 | 3300049523 | Unclassified | 3323 |
| 139 | Ga0501202_011642 | 3300049652 | Bacteria | 1650 |
| 140 | Ga0501207_005128 | 3300049654 | Bacteria | 1806 |
| 141 | Ga0501210_000969 | 3300049657 | Bacteria | 1532 |
| 142 | Ga0501217_011903 | 3300049661 | Unclassified | 1930 |
| 143 | Ga0501238_002929 | 3300049671 | Unclassified | 2074 |
| 144 | Ga0501257_000509 | 3300049686 | Bacteria | 7733 |
| 145 | Ga0501257_001931 | 3300049686 | Bacteria | 4313 |
| 146 | Ga0501264_000206 | 3300049761 | Bacteria | 9557 |
| 147 | nmdc:mga08y16_53385_c1 | 3300050511 | Bacteria | 4226 |
| 148 | Ga0500644_0007205 | 3300053088 | Bacteria | 2888 |
| 149 | Ga0500650_0130237 | 3300053098 | Bacteria | 1170 |
| 150 | Ga0500655_028030 | 3300053133 | Bacteria | 1077 |
| 151 | Ga0500604_0002589 | 3300053151 | Bacteria | 4927 |
| 152 | Ga0500616_0000051 | 3300053153 | Bacteria | 296240 |
| 153 | Ga0500616_0007954 | 3300053153 | Bacteria | 6657 |
| 154 | Ga0500622_0000392 | 3300053156 | Bacteria | 42200 |
| 155 | Ga0500622_0000394 | 3300053156 | Bacteria | 42087 |
| 156 | Ga0500622_0008135 | 3300053156 | Bacteria | 5894 |
| 157 | 2919694923 | 2919692658 | Bacteria | 5943958 |
| 158 | 2958513164 | 2958512119 | Bacteria | 4528530 |
| 159 | Ga0451577_0114806 | |||
| 160 | rootH1_10005066 | |||
| 161 | rootH1_10040569 | |||
| 162 | rootH2_10021704 | |||
| 163 | rootH2_10029861 | |||
| 164 | rootH2_10219748 | |||
| 165 | rootL2_10004418 | |||
| 166 | rootL2_10004419 | |||
| 167 | rootL2_10033074 | |||
| 168 | rootL2_10072791 | |||
| 169 | rootL2_10103343 | |||
| 170 | rootL2_10108482 | |||
| 171 | rootH1_10007162 | |||
| 172 | rootH1_10015499 | |||
| 173 | rootH1_10107066 | |||
| 174 | rootH1_10147679 | |||
| 175 | rootH1_10193617 | |||
| 176 | Ga0055531_10000148 | |||
| 177 | Ga0065165_1001087 | |||
| 178 | Ga0065715_10005180 | |||
| 179 | Ga0070713_100266073 | |||
| 180 | Ga0070672_100064962 | |||
| 181 | Ga0068855_100668838 | |||
| 182 | Ga0068856_100013929 | |||
| 183 | Ga0068856_100032243 | |||
| 184 | Ga0068852_100337813 | |||
| 185 | Ga0068864_100232930 | |||
| 186 | Ga0068864_100475319 | |||
| 187 | Ga0068862_100055145 | |||
| 188 | Ga0068862_100081738 | |||
| 189 | Ga0075428_100036093 | |||
| 190 | Ga0111539_10021088 | |||
| 191 | Ga0111539_10060119 | |||
| 192 | Ga0105242_10044708 | |||
| 193 | Ga0157370_10580050 | |||
| 194 | Ga0163162_10059803 | |||
| 195 | Ga0157372_10123471 | |||
| 196 | Ga0157375_10009601 | |||
| 197 | Ga0163163_10120400 | |||
| 198 | Ga0157380_10000001 | |||
| 199 | Ga0157380_10057802 | |||
| 200 | Ga0157376_10050030 | |||
| 201 | Ga0209050_1001692 | |||
| 202 | Ga0209050_1012594 | |||
| 203 | Ga0209257_1000006 | |||
| 204 | Ga0207700_10109734 | |||
| 205 | Ga0207665_10081561 | |||
| 206 | Ga0207702_10010426 | |||
| 207 | Ga0207676_10239034 | |||
| 208 | Ga0207698_10313063 | |||
| 209 | Ga0307515_10000009 | |||
| 210 | Ga0307515_10111889 | |||
| 211 | Ga0307515_10184433 | |||
| 212 | Ga0265338_10005892 | |||
| 213 | Ga0265327_10008439 | |||
| 214 | Ga0265327_10044677 | |||
| 215 | Ga0265316_10015931 | |||
| 216 | Ga0307513_10071802 | |||
| 217 | Ga0307509_10082892 | |||
| 218 | Ga0307509_10129623 | |||
| 219 | Ga0307408_100050821 | |||
| 220 | Ga0307408_100062654 | |||
| 221 | Ga0307514_10047172 | |||
| 222 | Ga0316579_10135332 | |||
| 223 | Ga0316576_10022607 | |||
| 224 | Ga0316576_10041706 | |||
| 225 | Ga0316576_10105531 | |||
| 226 | Ga0316576_10449391 | |||
| 227 | Ga0316578_10016023 | |||
| 228 | Ga0316578_10073864 | |||
| 229 | Ga0307405_10308962 | |||
| 230 | Ga0316577_10015902 | |||
| 231 | Ga0307413_10028114 | |||
| 232 | Ga0307412_10336190 | |||
| 233 | Ga0307416_100037405 | |||
| 234 | Ga0307414_10000088 | |||
| 235 | Ga0307414_10001268 | |||
| 236 | Ga0307414_10012303 | |||
| 237 | Ga0307414_10015584 | |||
| 238 | Ga0307414_10020518 | |||
| 239 | Ga0307414_10328510 | |||
| 240 | Ga0307414_10728829 | |||
| 241 | Ga0316585_10050118 | |||
| 242 | Ga0316596_1053287 | |||
| 243 | Ga0316574_0002637 | |||
| 244 | Ga0373927_0015002 | |||
| 245 | Ga0373937_0355544 | |||
| 246 | Ga0316582_0307184 | |||
| 247 | Ga0316584_0006573 | |||
| 248 | Ga0316584_0019711 | |||
| 249 | Ga0395899_0000061 | |||
| 250 | Ga0395900_0250682 | |||
| 251 | Ga0395905_0000208 | |||
| 252 | Ga0395901_0001271 | |||
| 253 | Ga0400485_18269 | |||
| 254 | Ga0400486_19949 | |||
| 255 | Ga0400486_22976 | |||
| 256 | Ga0400483_015018 | |||
| 257 | Ga0400489_61526 | |||
| 258 | Ga0400487_21303 | |||
| 259 | Ga0400487_61490 | |||
| 260 | Ga0451577_0034061 | |||
| 261 | Ga0451577_0048565 | |||
| 262 | Ga0451577_0050522 | |||
| 263 | Ga0451577_0062985 | |||
| 264 | Ga0451577_0110681 | |||
| 265 | Ga0453683_0000078 | |||
| 266 | Ga0453683_0027827 | |||
| 267 | Ga0453683_0050899 | |||
| 268 | Ga0453683_0123196 | |||
| 269 | Ga0453683_0145018 | |||
| 270 | Ga0453684_0000161 | |||
| 271 | Ga0453684_0000311 | |||
| 272 | Ga0453684_0000547 | |||
| 273 | Ga0453684_0001960 | |||
| 274 | Ga0453684_0002363 | |||
| 275 | Ga0453684_0005524 | |||
| 276 | Ga0453684_0011057 | |||
| 277 | Ga0453684_0011552 | |||
| 278 | Ga0453684_0013912 | |||
| 279 | Ga0453684_0016040 | |||
| 280 | Ga0453684_0099612 | |||
| 281 | Ga0453684_0111363 | |||
| 282 | Ga0453684_0262298 | |||
| 283 | Ga0451576_0000059 | |||
| 284 | Ga0451576_0003315 | |||
| 285 | Ga0451576_0003859 | |||
| 286 | Ga0451576_0017598 | |||
| 287 | Ga0451576_0519837 | |||
| 288 | Ga0451576_0607666 | |||
| 289 | Ga0495592_0166267 | |||
| 290 | Ga0495638_0000197 | |||
| 291 | Ga0495634_0025778 | |||
| 292 | Ga0495625_0006982 | |||
| 293 | Ga0495599_0194703 | |||
| 294 | Ga0495670_0020906 | |||
| 295 | Ga0495581_0110975 | |||
| 296 | Ga0501300_001673 | |||
| 297 | Ga0501202_011642 | |||
| 298 | Ga0501207_005128 | |||
| 299 | Ga0501210_000969 | |||
| 300 | Ga0501217_011903 | |||
| 301 | Ga0501238_002929 | |||
| 302 | Ga0501257_000509 | |||
| 303 | Ga0501257_001931 | |||
| 304 | Ga0501264_000206 | |||
| 305 | nmdc:mga08y16_53385_c1 | |||
| 306 | Ga0500644_0007205 | |||
| 307 | Ga0500650_0130237 | |||
| 308 | Ga0500655_028030 | |||
| 309 | Ga0500604_0002589 | |||
| 310 | Ga0500616_0000051 | |||
| 311 | Ga0500616_0007954 | |||
| 312 | Ga0500622_0000392 | |||
| 313 | Ga0500622_0000394 | |||
| 314 | Ga0500622_0008135 | |||
| 315 | 2919694923 | |||
| 316 | 2958513164 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qw4-assembly1.cif.gz_B | structure of leishmania donovani ump synthase | 0.9527 | 2 | 251 |
| 3qw3-assembly1.cif.gz_A | structure of leishmania donovani omp decarboxylase | 0.9489 | 2 | 251 |
| 3qw3-assembly1.cif.gz_B | structure of leishmania donovani omp decarboxylase | 0.9487 | 2 | 251 |
| 3qw4-assembly1.cif.gz_C | structure of leishmania donovani ump synthase | 0.9126 | 1 | 248 |
| 3r89-assembly1.cif.gz_B | crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548 | 0.8969 | 1 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3qw4B01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9528 | 2 | 251 | 3.20.20.70 |
| af_Q4DBZ4_1_160_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8886 | 88 | 249 | 3.20.20.70 |
| 3qw4B01 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8831 | 2 | 251 | 3.20.20.70 |
| 3n2mA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8781 | 1 | 254 | 3.20.20.70 |
| af_Q4DBZ4_1_160_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.873 | 88 | 249 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354XZD0-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) | 0.9995 | 71 | 125 |
GO:0004590
GO:0006207 GO:0044205 |
| AF-A0A2M6GLV7-F1-model_v4 | Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) | 0.9964 | 1 | 89 |
GO:0004590
GO:0006207 GO:0044205 |
| AF-A0A800F1F8-F1-model_v4 | Orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) | 0.9955 | 28 | 133 |
GO:0004590
GO:0006207 GO:0044205 |
| AF-A0A7R9ADB1-F1-model_v4 | orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) | 0.9948 | 2 | 252 |
GO:0004590
GO:0005524 GO:0006207 GO:0016226 GO:0044205 GO:0046872 GO:0051539 GO:0140663 |
| AF-A0A4Q5UY21-F1-model_v4 | Orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) | 0.9934 | 1 | 143 |
GO:0004590
GO:0006207 GO:0044205 |