F230283

General Info

Members Datasets Scaffolds Average Seq Length
158 92 316 272

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0114806|Ga0451577_0114806_951_1841
Length 296
Sequence MQKCSTQNTIFVQEKNNTIMNAVQLFEEIRKKRSFLCIGLDTDIQKIPRHLMDTTDPIFTFNKEIIDHTHDLAVAYKPNLAFYESLGAEGWVSLDKTVKYIREKYPELFIIADAKRGDIGNTSSLYARAFFDHFDFDAVTVAPYMGEDSVKPFMTYIDKWVIVLALTSNKGAFDFQFLKDEKSGDLLFESVLKTSKTWGTTDNMMYVVGATKAEKLEEIRQIVPDHFLLVPGVGAQGGSLQEVAGYGMNSQCGLLVNSSRAIIYASDGEDFAQLARQEAENVQLEMEELLLEAELL

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
27 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
41 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
42 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
43 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
48 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
49 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
50 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
51 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
62 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
65 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
66 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
77 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
78 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
79 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
80 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
81 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
82 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
83 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
84 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
85 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
86 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
87 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
88 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
89 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
90 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
91 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
92 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 0.63
Isolates 1.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.86
Nodule 0
Rhizoplane 0
Rhizosphere 72.15
Stem 0
Stem Tuber 0
Unclassified 8.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0114806 3300042876 Bacteria 2411
2 rootH1_10005066 3300003316 Bacteria 17676
3 rootH1_10040569 3300003316 Bacteria 1314
4 rootH2_10021704 3300003320 Bacteria 49464
5 rootH2_10029861 3300003320 Bacteria 3099
6 rootH2_10219748 3300003320 Bacteria 2486
7 rootL2_10004418 3300003322 Bacteria 2780
8 rootL2_10004419 3300003322 Bacteria 2371
9 rootL2_10033074 3300003322 Bacteria 1683
10 rootL2_10072791 3300003322 Bacteria 6593
11 rootL2_10103343 3300003322 Bacteria 7358
12 rootL2_10108482 3300003322 Bacteria 3472
13 rootH1_10007162 3300003323 Bacteria 4311
14 rootH1_10015499 3300003323 Bacteria 86587
15 rootH1_10107066 3300003323 Bacteria 9463
16 rootH1_10147679 3300003323 Bacteria 2687
17 rootH1_10193617 3300003323 Bacteria 2018
18 Ga0055531_10000148 3300003794 Bacteria 80963
19 Ga0065165_1001087 3300005262 Bacteria 32424
20 Ga0065715_10005180 3300005293 Bacteria 3725
21 Ga0070713_100266073 3300005436 Bacteria 1568
22 Ga0070672_100064962 3300005543 Bacteria 2885
23 Ga0068855_100668838 3300005563 Bacteria 1114
24 Ga0068856_100013929 3300005614 Bacteria 7778
25 Ga0068856_100032243 3300005614 Bacteria 5129
26 Ga0068852_100337813 3300005616 Bacteria 1467
27 Ga0068864_100232930 3300005618 Unclassified 1704
28 Ga0068864_100475319 3300005618 Bacteria 1199
29 Ga0068862_100055145 3300005844 Bacteria 3404
30 Ga0068862_100081738 3300005844 Bacteria 2803
31 Ga0075428_100036093 3300006844 Bacteria 5448
32 Ga0111539_10021088 3300009094 Bacteria 8023
33 Ga0111539_10060119 3300009094 Bacteria 4504
34 Ga0105242_10044708 3300009176 Unclassified 3587
35 Ga0157370_10580050 3300013104 Unclassified 1027
36 Ga0163162_10059803 3300013306 Bacteria 3843
37 Ga0157372_10123471 3300013307 Unclassified 2976
38 Ga0157375_10009601 3300013308 Bacteria 8500
39 Ga0163163_10120400 3300014325 Bacteria 2658
40 Ga0157380_10000001 3300014326 Bacteria 254890
41 Ga0157380_10057802 3300014326 Bacteria 3090
42 Ga0157376_10050030 3300014969 Bacteria 3465
43 Ga0209050_1001692 3300025298 Bacteria 22112
44 Ga0209050_1012594 3300025298 Bacteria 3859
45 Ga0209257_1000006 3300025304 Bacteria 1570111
46 Ga0207700_10109734 3300025928 Bacteria 2218
47 Ga0207665_10081561 3300025939 Bacteria 2227
48 Ga0207702_10010426 3300026078 Bacteria 7779
49 Ga0207676_10239034 3300026095 Bacteria 1628
50 Ga0207698_10313063 3300026142 Bacteria 1467
51 Ga0307515_10000009 3300028794 Bacteria 653206
52 Ga0307515_10111889 3300028794 Bacteria 3180
53 Ga0307515_10184433 3300028794 Bacteria 2022
54 Ga0265338_10005892 3300028800 Bacteria 15808
55 Ga0265327_10008439 3300031251 Bacteria 7667
56 Ga0265327_10044677 3300031251 Unclassified 2360
57 Ga0265316_10015931 3300031344 Bacteria 6544
58 Ga0307513_10071802 3300031456 Bacteria 3611
59 Ga0307509_10082892 3300031507 Bacteria 3307
60 Ga0307509_10129623 3300031507 Bacteria 2481
61 Ga0307408_100050821 3300031548 Bacteria 2983
62 Ga0307408_100062654 3300031548 Bacteria 2718
63 Ga0307514_10047172 3300031649 Bacteria 3364
64 Ga0316579_10135332 3300031691 Bacteria 1187
65 Ga0316576_10022607 3300031727 Bacteria 4369
66 Ga0316576_10041706 3300031727 Bacteria 3306
67 Ga0316576_10105531 3300031727 Bacteria 2109
68 Ga0316576_10449391 3300031727 Bacteria 952
69 Ga0316578_10016023 3300031728 Bacteria 4047
70 Ga0316578_10073864 3300031728 Bacteria 2021
71 Ga0307405_10308962 3300031731 Bacteria 1203
72 Ga0316577_10015902 3300031733 Bacteria 4142
73 Ga0307413_10028114 3300031824 Bacteria 3126
74 Ga0307412_10336190 3300031911 Bacteria 1207
75 Ga0307416_100037405 3300032002 Bacteria 3734
76 Ga0307414_10000088 3300032004 Bacteria 84711
77 Ga0307414_10001268 3300032004 Bacteria 13016
78 Ga0307414_10012303 3300032004 Bacteria 5053
79 Ga0307414_10015584 3300032004 Bacteria 4590
80 Ga0307414_10020518 3300032004 Bacteria 4121
81 Ga0307414_10328510 3300032004 Bacteria 1304
82 Ga0307414_10728829 3300032004 Bacteria 900
83 Ga0316585_10050118 3300032137 Bacteria 1340
84 Ga0316596_1053287 3300033541 Bacteria 1073
85 Ga0316574_0002637 3300035398 Bacteria 9050
86 Ga0373927_0015002 3300035695 Bacteria 5126
87 Ga0373937_0355544 3300036401 Bacteria 1388
88 Ga0316582_0307184 3300036647 Unclassified 1090
89 Ga0316584_0006573 3300036712 Bacteria 7875
90 Ga0316584_0019711 3300036712 Bacteria 4877
91 Ga0395899_0000061 3300037312 Bacteria 212002
92 Ga0395900_0250682 3300037418 Unclassified 1772
93 Ga0395905_0000208 3300037471 Bacteria 91236
94 Ga0395901_0001271 3300038443 Bacteria 26750
95 Ga0400485_18269 3300038735 Bacteria 31127
96 Ga0400486_19949 3300038742 Bacteria 17433
97 Ga0400486_22976 3300038742 Bacteria 93315
98 Ga0400483_015018 3300039062 Bacteria 97237
99 Ga0400489_61526 3300039093 Bacteria 22718
100 Ga0400487_21303 3300039110 Bacteria 74949
101 Ga0400487_61490 3300039110 Bacteria 4487
102 Ga0451577_0034061 3300042876 Bacteria 4593
103 Ga0451577_0048565 3300042876 Bacteria 3791
104 Ga0451577_0050522 3300042876 Unclassified 3712
105 Ga0451577_0062985 3300042876 Bacteria 3307
106 Ga0451577_0110681 3300042876 Bacteria 2457
107 Ga0453683_0000078 3300044673 Bacteria 147056
108 Ga0453683_0027827 3300044673 Bacteria 3582
109 Ga0453683_0050899 3300044673 Bacteria 2595
110 Ga0453683_0123196 3300044673 Bacteria 1632
111 Ga0453683_0145018 3300044673 Bacteria 1499
112 Ga0453684_0000161 3300044712 Bacteria 298175
113 Ga0453684_0000311 3300044712 Bacteria 206847
114 Ga0453684_0000547 3300044712 Bacteria 142253
115 Ga0453684_0001960 3300044712 Bacteria 53054
116 Ga0453684_0002363 3300044712 Bacteria 46117
117 Ga0453684_0005524 3300044712 Bacteria 24951
118 Ga0453684_0011057 3300044712 Bacteria 15244
119 Ga0453684_0011552 3300044712 Bacteria 14771
120 Ga0453684_0013912 3300044712 Bacteria 12979
121 Ga0453684_0016040 3300044712 Bacteria 11761
122 Ga0453684_0099612 3300044712 Bacteria 3559
123 Ga0453684_0111363 3300044712 Bacteria 3325
124 Ga0453684_0262298 3300044712 Bacteria 1978
125 Ga0451576_0000059 3300045051 Bacteria 296795
126 Ga0451576_0003315 3300045051 Bacteria 22330
127 Ga0451576_0003859 3300045051 Bacteria 20105
128 Ga0451576_0017598 3300045051 Bacteria 7854
129 Ga0451576_0519837 3300045051 Bacteria 1250
130 Ga0451576_0607666 3300045051 Unclassified 1149
131 Ga0495592_0166267 3300046454 Bacteria 1514
132 Ga0495638_0000197 3300046460 Bacteria 86853
133 Ga0495634_0025778 3300046642 Bacteria 4107
134 Ga0495625_0006982 3300046660 Bacteria 9954
135 Ga0495599_0194703 3300046678 Unclassified 1246
136 Ga0495670_0020906 3300046691 Bacteria 3227
137 Ga0495581_0110975 3300047315 Unclassified 1595
138 Ga0501300_001673 3300049523 Unclassified 3323
139 Ga0501202_011642 3300049652 Bacteria 1650
140 Ga0501207_005128 3300049654 Bacteria 1806
141 Ga0501210_000969 3300049657 Bacteria 1532
142 Ga0501217_011903 3300049661 Unclassified 1930
143 Ga0501238_002929 3300049671 Unclassified 2074
144 Ga0501257_000509 3300049686 Bacteria 7733
145 Ga0501257_001931 3300049686 Bacteria 4313
146 Ga0501264_000206 3300049761 Bacteria 9557
147 nmdc:mga08y16_53385_c1 3300050511 Bacteria 4226
148 Ga0500644_0007205 3300053088 Bacteria 2888
149 Ga0500650_0130237 3300053098 Bacteria 1170
150 Ga0500655_028030 3300053133 Bacteria 1077
151 Ga0500604_0002589 3300053151 Bacteria 4927
152 Ga0500616_0000051 3300053153 Bacteria 296240
153 Ga0500616_0007954 3300053153 Bacteria 6657
154 Ga0500622_0000392 3300053156 Bacteria 42200
155 Ga0500622_0000394 3300053156 Bacteria 42087
156 Ga0500622_0008135 3300053156 Bacteria 5894
157 2919694923 2919692658 Bacteria 5943958
158 2958513164 2958512119 Bacteria 4528530
159 Ga0451577_0114806
160 rootH1_10005066
161 rootH1_10040569
162 rootH2_10021704
163 rootH2_10029861
164 rootH2_10219748
165 rootL2_10004418
166 rootL2_10004419
167 rootL2_10033074
168 rootL2_10072791
169 rootL2_10103343
170 rootL2_10108482
171 rootH1_10007162
172 rootH1_10015499
173 rootH1_10107066
174 rootH1_10147679
175 rootH1_10193617
176 Ga0055531_10000148
177 Ga0065165_1001087
178 Ga0065715_10005180
179 Ga0070713_100266073
180 Ga0070672_100064962
181 Ga0068855_100668838
182 Ga0068856_100013929
183 Ga0068856_100032243
184 Ga0068852_100337813
185 Ga0068864_100232930
186 Ga0068864_100475319
187 Ga0068862_100055145
188 Ga0068862_100081738
189 Ga0075428_100036093
190 Ga0111539_10021088
191 Ga0111539_10060119
192 Ga0105242_10044708
193 Ga0157370_10580050
194 Ga0163162_10059803
195 Ga0157372_10123471
196 Ga0157375_10009601
197 Ga0163163_10120400
198 Ga0157380_10000001
199 Ga0157380_10057802
200 Ga0157376_10050030
201 Ga0209050_1001692
202 Ga0209050_1012594
203 Ga0209257_1000006
204 Ga0207700_10109734
205 Ga0207665_10081561
206 Ga0207702_10010426
207 Ga0207676_10239034
208 Ga0207698_10313063
209 Ga0307515_10000009
210 Ga0307515_10111889
211 Ga0307515_10184433
212 Ga0265338_10005892
213 Ga0265327_10008439
214 Ga0265327_10044677
215 Ga0265316_10015931
216 Ga0307513_10071802
217 Ga0307509_10082892
218 Ga0307509_10129623
219 Ga0307408_100050821
220 Ga0307408_100062654
221 Ga0307514_10047172
222 Ga0316579_10135332
223 Ga0316576_10022607
224 Ga0316576_10041706
225 Ga0316576_10105531
226 Ga0316576_10449391
227 Ga0316578_10016023
228 Ga0316578_10073864
229 Ga0307405_10308962
230 Ga0316577_10015902
231 Ga0307413_10028114
232 Ga0307412_10336190
233 Ga0307416_100037405
234 Ga0307414_10000088
235 Ga0307414_10001268
236 Ga0307414_10012303
237 Ga0307414_10015584
238 Ga0307414_10020518
239 Ga0307414_10328510
240 Ga0307414_10728829
241 Ga0316585_10050118
242 Ga0316596_1053287
243 Ga0316574_0002637
244 Ga0373927_0015002
245 Ga0373937_0355544
246 Ga0316582_0307184
247 Ga0316584_0006573
248 Ga0316584_0019711
249 Ga0395899_0000061
250 Ga0395900_0250682
251 Ga0395905_0000208
252 Ga0395901_0001271
253 Ga0400485_18269
254 Ga0400486_19949
255 Ga0400486_22976
256 Ga0400483_015018
257 Ga0400489_61526
258 Ga0400487_21303
259 Ga0400487_61490
260 Ga0451577_0034061
261 Ga0451577_0048565
262 Ga0451577_0050522
263 Ga0451577_0062985
264 Ga0451577_0110681
265 Ga0453683_0000078
266 Ga0453683_0027827
267 Ga0453683_0050899
268 Ga0453683_0123196
269 Ga0453683_0145018
270 Ga0453684_0000161
271 Ga0453684_0000311
272 Ga0453684_0000547
273 Ga0453684_0001960
274 Ga0453684_0002363
275 Ga0453684_0005524
276 Ga0453684_0011057
277 Ga0453684_0011552
278 Ga0453684_0013912
279 Ga0453684_0016040
280 Ga0453684_0099612
281 Ga0453684_0111363
282 Ga0453684_0262298
283 Ga0451576_0000059
284 Ga0451576_0003315
285 Ga0451576_0003859
286 Ga0451576_0017598
287 Ga0451576_0519837
288 Ga0451576_0607666
289 Ga0495592_0166267
290 Ga0495638_0000197
291 Ga0495634_0025778
292 Ga0495625_0006982
293 Ga0495599_0194703
294 Ga0495670_0020906
295 Ga0495581_0110975
296 Ga0501300_001673
297 Ga0501202_011642
298 Ga0501207_005128
299 Ga0501210_000969
300 Ga0501217_011903
301 Ga0501238_002929
302 Ga0501257_000509
303 Ga0501257_001931
304 Ga0501264_000206
305 nmdc:mga08y16_53385_c1
306 Ga0500644_0007205
307 Ga0500650_0130237
308 Ga0500655_028030
309 Ga0500604_0002589
310 Ga0500616_0000051
311 Ga0500616_0007954
312 Ga0500622_0000392
313 Ga0500622_0000394
314 Ga0500622_0008135
315 2919694923
316 2958513164

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00215

OMPdecase

Orotidine 5'-phosphate decarboxylase / HUMPS family

34

274

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qw4-assembly1.cif.gz_B structure of leishmania donovani ump synthase 0.9527 2 251
3qw3-assembly1.cif.gz_A structure of leishmania donovani omp decarboxylase 0.9489 2 251
3qw3-assembly1.cif.gz_B structure of leishmania donovani omp decarboxylase 0.9487 2 251
3qw4-assembly1.cif.gz_C structure of leishmania donovani ump synthase 0.9126 1 248
3r89-assembly1.cif.gz_B crystal structure of orotidine 5-phosphate decarboxylase from anaerococcus prevotii dsm 20548 0.8969 1 251
ID Description Score Start End Superfamily
3qw4B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9528 2 251 3.20.20.70
af_Q4DBZ4_1_160_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8886 88 249 3.20.20.70
3qw4B01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8831 2 251 3.20.20.70
3n2mA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8781 1 254 3.20.20.70
af_Q4DBZ4_1_160_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.873 88 249 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A354XZD0-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9995 71 125 GO:0004590
GO:0006207
GO:0044205
AF-A0A2M6GLV7-F1-model_v4 Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) 0.9964 1 89 GO:0004590
GO:0006207
GO:0044205
AF-A0A800F1F8-F1-model_v4 Orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) 0.9955 28 133 GO:0004590
GO:0006207
GO:0044205
AF-A0A7R9ADB1-F1-model_v4 orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) 0.9948 2 252 GO:0004590
GO:0005524
GO:0006207
GO:0016226
GO:0044205
GO:0046872
GO:0051539
GO:0140663
AF-A0A4Q5UY21-F1-model_v4 Orotidine-5'-phosphate decarboxylase (EC 4.1.1.23) 0.9934 1 143 GO:0004590
GO:0006207
GO:0044205

Map