F229743

General Info

Members Datasets Scaffolds Average Seq Length
158 121 316 141

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_11502953|Ga0157377_115029531
Length 157
Sequence VRRVSSGASPIDGGAATWEHRGMTSRLNPYISFKDTARQALEFYQQVFGGELSINTFGEYGQADTPIADLVMHGMLETPNGFTLMGADTPPGMDYTPGTTMTVSLSGDDADLLQGYWDKLSEGGNVGVPLERQMWGDTFGMVVDRFGTPWMVNIAGS

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
41 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
67 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
74 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
80 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
90 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
91 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
92 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
93 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
94 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
95 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
96 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
97 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
98 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
99 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
100 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
103 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
104 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
105 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
106 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
107 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
108 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
111 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
112 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
113 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
114 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
115 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
116 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
117 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
119 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
120 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
121 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.24
Metatranscriptomes 8.23
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.09
Nodule 1.27
Rhizoplane 1.27
Rhizosphere 79.75
Stem 0
Stem Tuber 0
Unclassified 20.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_11502953 3300014745 Bacteria 535
2 LJQas_1000691 3300000549 Bacteria 5374
3 LJQas_1002509 3300000549 Bacteria 2542
4 Ga0007416J51690_1039007 3300003577 Bacteria 1127
5 JGI25405J52794_10013352 3300003911 Bacteria 1592
6 Ga0070658_10438780 3300005327 Bacteria 1124
7 Ga0070683_100005447 3300005329 Bacteria 10630
8 Ga0070705_100058075 3300005440 Bacteria 2285
9 Ga0070678_100466206 3300005456 Bacteria 1109
10 Ga0070706_100006824 3300005467 Bacteria 10779
11 Ga0070706_100133422 3300005467 Bacteria 2317
12 Ga0070706_100523006 3300005467 Bacteria 1104
13 Ga0070707_100013894 3300005468 Bacteria 7541
14 Ga0070707_100143664 3300005468 Bacteria 2322
15 Ga0070707_100735649 3300005468 Bacteria 950
16 Ga0070698_100144575 3300005471 Bacteria 2328
17 Ga0070684_100000154 3300005535 Bacteria 47112
18 Ga0070697_100007122 3300005536 Bacteria 8696
19 Ga0070697_100117629 3300005536 Bacteria 2220
20 Ga0070695_100009804 3300005545 Bacteria 5706
21 Ga0070664_100514411 3300005564 Bacteria 1104
22 Ga0068860_101562913 3300005843 Bacteria 681
23 Ga0081455_10000409 3300005937 Bacteria 56312
24 Ga0081538_10074807 3300005981 Bacteria 1842
25 Ga0070717_10126754 3300006028 Bacteria 2192
26 Ga0070717_10574203 3300006028 Unclassified 1022
27 Ga0075365_10000003 3300006038 Bacteria 203750
28 Ga0075363_100118224 3300006048 Bacteria 1478
29 Ga0075364_10000208 3300006051 Bacteria 27614
30 Ga0075364_10480002 3300006051 Unclassified 850
31 Ga0070716_100211727 3300006173 Bacteria 1296
32 Ga0070712_100922274 3300006175 Bacteria 754
33 Ga0075367_10463761 3300006178 Bacteria 803
34 Ga0075369_10087712 3300006186 Bacteria 1386
35 Ga0075369_10184880 3300006186 Unclassified 959
36 Ga0075428_100006360 3300006844 Bacteria 13142
37 Ga0075430_100001581 3300006846 Bacteria 18597
38 Ga0075431_100082116 3300006847 Bacteria 3327
39 Ga0075431_101094935 3300006847 Unclassified 761
40 Ga0075434_100481740 3300006871 Bacteria 1262
41 Ga0075429_100006112 3300006880 Bacteria 10409
42 Ga0075436_100008949 3300006914 Bacteria 6853
43 Ga0075435_101780120 3300007076 Unclassified 541
44 Ga0105245_11633015 3300009098 Bacteria 696
45 Ga0114129_10114978 3300009147 Bacteria 3710
46 Ga0114129_11816534 3300009147 Unclassified 741
47 Ga0114129_12278130 3300009147 Bacteria 650
48 Ga0157371_10464821 3300013102 Unclassified 931
49 Ga0157378_10694919 3300013297 Bacteria 1036
50 Ga0197907_10275041 3300020069 Unclassified 566
51 Ga0206356_11745941 3300020070 Bacteria 629
52 Ga0206355_1342981 3300020076 Bacteria 887
53 Ga0206351_10470710 3300020077 Unclassified 543
54 Ga0206352_10677539 3300020078 Unclassified 541
55 Ga0206350_10381001 3300020080 Bacteria 1015
56 Ga0206350_10511038 3300020080 Unclassified 505
57 Ga0206354_10399208 3300020081 Eukaryota 636
58 Ga0206354_10875951 3300020081 Unclassified 756
59 Ga0224712_10592077 3300022467 Unclassified 541
60 Ga0224712_10692518 3300022467 Unclassified 501
61 Ga0207705_10487004 3300025909 Bacteria 957
62 Ga0207684_10009954 3300025910 Bacteria 8382
63 Ga0207684_10066988 3300025910 Bacteria 3050
64 Ga0207684_10502699 3300025910 Bacteria 1039
65 Ga0207693_10299268 3300025915 Bacteria 1260
66 Ga0207693_10773621 3300025915 Unclassified 741
67 Ga0207646_10040697 3300025922 Unclassified 4179
68 Ga0207646_10123276 3300025922 Bacteria 2329
69 Ga0207700_10304624 3300025928 Bacteria 1377
70 Ga0207669_11553083 3300025937 Bacteria 565
71 Ga0207661_10000029 3300025944 Bacteria 172511
72 Ga0207679_10407687 3300025945 Bacteria 1197
73 Ga0207674_10048890 3300026116 Unclassified 4327
74 Ga0207683_10176554 3300026121 Bacteria 1936
75 Ga0207698_11971654 3300026142 Bacteria 598
76 Ga0207428_10009680 3300027907 Bacteria 8635
77 Ga0268264_11262256 3300028381 Bacteria 749
78 Ga0307408_101191962 3300031548 Bacteria 710
79 Ga0307413_10518822 3300031824 Bacteria 960
80 Ga0307410_10829200 3300031852 Bacteria 788
81 Ga0307409_100427569 3300031995 Bacteria 1272
82 Ga0307416_100837979 3300032002 Bacteria 1017
83 Ga0307411_11459420 3300032005 Bacteria 628
84 Ga0316574_0862302 3300035398 Unclassified 549
85 Ga0316584_0295453 3300036712 Bacteria 1174
86 Ga0451795_0492642 3300041456 Unclassified 621
87 Ga0466963_0705240 3300044694 Bacteria 712
88 Ga0453684_0002185 3300044712 Bacteria 48758
89 Ga0453684_0002781 3300044712 Bacteria 41384
90 Ga0453684_0034897 3300044712 Bacteria 6967
91 Ga0453684_0350134 3300044712 Unclassified 1666
92 Ga0453684_0544215 3300044712 Bacteria 1280
93 Ga0453684_0914141 3300044712 Unclassified 939
94 Ga0453684_1847072 3300044712 Bacteria 613
95 Ga0451576_0001095 3300045051 Bacteria 49461
96 Ga0451576_0005844 3300045051 Bacteria 15281
97 Ga0466958_0168934 3300045836 Bacteria 1384
98 Ga0495580_0013821 3300046472 Bacteria 6147
99 Ga0495639_0003379 3300046475 Bacteria 6914
100 Ga0495665_0016796 3300046531 Bacteria 3939
101 Ga0495586_0009137 3300046535 Bacteria 5272
102 Ga0495670_0101182 3300046691 Bacteria 1484
103 Ga0495600_0096840 3300046809 Bacteria 1923
104 Ga0495581_0003688 3300047315 Bacteria 8819
105 Ga0495581_0092866 3300047315 Bacteria 1751
106 Ga0495677_0019637 3300047445 Bacteria 2450
107 Ga0495593_0012370 3300047673 Bacteria 4877
108 Ga0496113_1063090 3300048916 Bacteria 636
109 Ga0501041_0108380 3300049577 Bacteria 1723
110 Ga0501047_0943934 3300049581 Bacteria 676
111 Ga0501048_0303601 3300049582 Bacteria 1136
112 Ga0501071_0782494 3300049587 Bacteria 735
113 Ga0501075_0619666 3300049591 Bacteria 825
114 Ga0501076_0144912 3300049592 Bacteria 1931
115 Ga0501045_0321307 3300049824 Bacteria 1152
116 nmdc:mga03n38_429491_c1 3300050490 Bacteria 732
117 nmdc:mga00v17_368264_c1 3300050491 Unclassified 934
118 nmdc:mga00v17_82_c1 3300050491 Bacteria 57586
119 nmdc:mga0yw44_10_c1 3300050492 Bacteria 154783
120 nmdc:mga06z11_517733_c1 3300050494 Bacteria 723
121 nmdc:mga05p37_435161_c1 3300050507 Bacteria 1523
122 nmdc:mga05p37_922_c1 3300050507 Bacteria 33178
123 nmdc:mga09592_154_c1 3300050508 Bacteria 47375
124 nmdc:mga0qj67_2167_c1 3300050509 Bacteria 13961
125 nmdc:mga06r32_130_c1 3300050510 Bacteria 55123
126 nmdc:mga06r32_1343894_c1 3300050510 Unclassified 658
127 nmdc:mga08y16_17710_c1 3300050511 Bacteria 7503
128 nmdc:mga0n895_1485481_c1 3300050512 Bacteria 644
129 nmdc:mga0n895_792784_c1 3300050512 Unclassified 938
130 nmdc:mga0rr50_75974_c1 3300050513 Bacteria 2577
131 nmdc:mga0rr50_994906_c1 3300050513 Unclassified 714
132 nmdc:mga08x19_6_c2 3300050514 Bacteria 52011
133 nmdc:mga0a205_46048_c1 3300050515 Bacteria 4206
134 nmdc:mga0a205_894505_c1 3300050515 Bacteria 735
135 nmdc:mga0sz30_100026_c1 3300050516 Bacteria 1266
136 nmdc:mga0sz30_33700_c1 3300050516 Bacteria 1746
137 nmdc:mga0sz30_52904_c1 3300050516 Bacteria 1724
138 Ga0500644_0001070 3300053088 Bacteria 8084
139 Ga0500644_0267249 3300053088 Unclassified 725
140 Ga0500583_0000137 3300053092 Bacteria 31497
141 Ga0500583_0255514 3300053092 Unclassified 864
142 Ga0500628_000944 3300053129 Bacteria 5112
143 Ga0500642_0097647 3300053130 Unclassified 1363
144 Ga0500577_0000696 3300053142 Bacteria 8607
145 Ga0500589_000016 3300053147 Bacteria 107090
146 Ga0500616_0295250 3300053153 Unclassified 675
147 Ga0500637_0319617 3300053178 Unclassified 839
148 Ga0500570_000001 3300053724 Bacteria 243552
149 Ga0500611_000544 3300053727 Unclassified 3819
150 Ga0590071_000338 3300059421 Bacteria 13715
151 Ga0590074_001667 3300059423 Bacteria 3620
152 Ga0590075_000622 3300059424 Bacteria 9487
153 Ga0590077_001669 3300059426 Bacteria 5076
154 Ga0587082_032155 3300059504 Unclassified 920
155 2753072997 2751185734 Bacteria 8863695
156 2862392852 2862382967 Bacteria 10317375
157 2863412464 2863404153 Bacteria 9672205
158 8008565806 8008558824 Bacteria 10610750
159 Ga0157377_11502953
160 LJQas_1000691
161 LJQas_1002509
162 Ga0007416J51690_1039007
163 JGI25405J52794_10013352
164 Ga0070658_10438780
165 Ga0070683_100005447
166 Ga0070705_100058075
167 Ga0070678_100466206
168 Ga0070706_100006824
169 Ga0070706_100133422
170 Ga0070706_100523006
171 Ga0070707_100013894
172 Ga0070707_100143664
173 Ga0070707_100735649
174 Ga0070698_100144575
175 Ga0070684_100000154
176 Ga0070697_100007122
177 Ga0070697_100117629
178 Ga0070695_100009804
179 Ga0070664_100514411
180 Ga0068860_101562913
181 Ga0081455_10000409
182 Ga0081538_10074807
183 Ga0070717_10126754
184 Ga0070717_10574203
185 Ga0075365_10000003
186 Ga0075363_100118224
187 Ga0075364_10000208
188 Ga0075364_10480002
189 Ga0070716_100211727
190 Ga0070712_100922274
191 Ga0075367_10463761
192 Ga0075369_10087712
193 Ga0075369_10184880
194 Ga0075428_100006360
195 Ga0075430_100001581
196 Ga0075431_100082116
197 Ga0075431_101094935
198 Ga0075434_100481740
199 Ga0075429_100006112
200 Ga0075436_100008949
201 Ga0075435_101780120
202 Ga0105245_11633015
203 Ga0114129_10114978
204 Ga0114129_11816534
205 Ga0114129_12278130
206 Ga0157371_10464821
207 Ga0157378_10694919
208 Ga0197907_10275041
209 Ga0206356_11745941
210 Ga0206355_1342981
211 Ga0206351_10470710
212 Ga0206352_10677539
213 Ga0206350_10381001
214 Ga0206350_10511038
215 Ga0206354_10399208
216 Ga0206354_10875951
217 Ga0224712_10592077
218 Ga0224712_10692518
219 Ga0207705_10487004
220 Ga0207684_10009954
221 Ga0207684_10066988
222 Ga0207684_10502699
223 Ga0207693_10299268
224 Ga0207693_10773621
225 Ga0207646_10040697
226 Ga0207646_10123276
227 Ga0207700_10304624
228 Ga0207669_11553083
229 Ga0207661_10000029
230 Ga0207679_10407687
231 Ga0207674_10048890
232 Ga0207683_10176554
233 Ga0207698_11971654
234 Ga0207428_10009680
235 Ga0268264_11262256
236 Ga0307408_101191962
237 Ga0307413_10518822
238 Ga0307410_10829200
239 Ga0307409_100427569
240 Ga0307416_100837979
241 Ga0307411_11459420
242 Ga0316574_0862302
243 Ga0316584_0295453
244 Ga0451795_0492642
245 Ga0466963_0705240
246 Ga0453684_0002185
247 Ga0453684_0002781
248 Ga0453684_0034897
249 Ga0453684_0350134
250 Ga0453684_0544215
251 Ga0453684_0914141
252 Ga0453684_1847072
253 Ga0451576_0001095
254 Ga0451576_0005844
255 Ga0466958_0168934
256 Ga0495580_0013821
257 Ga0495639_0003379
258 Ga0495665_0016796
259 Ga0495586_0009137
260 Ga0495670_0101182
261 Ga0495600_0096840
262 Ga0495581_0003688
263 Ga0495581_0092866
264 Ga0495677_0019637
265 Ga0495593_0012370
266 Ga0496113_1063090
267 Ga0501041_0108380
268 Ga0501047_0943934
269 Ga0501048_0303601
270 Ga0501071_0782494
271 Ga0501075_0619666
272 Ga0501076_0144912
273 Ga0501045_0321307
274 nmdc:mga03n38_429491_c1
275 nmdc:mga00v17_368264_c1
276 nmdc:mga00v17_82_c1
277 nmdc:mga0yw44_10_c1
278 nmdc:mga06z11_517733_c1
279 nmdc:mga05p37_435161_c1
280 nmdc:mga05p37_922_c1
281 nmdc:mga09592_154_c1
282 nmdc:mga0qj67_2167_c1
283 nmdc:mga06r32_130_c1
284 nmdc:mga06r32_1343894_c1
285 nmdc:mga08y16_17710_c1
286 nmdc:mga0n895_1485481_c1
287 nmdc:mga0n895_792784_c1
288 nmdc:mga0rr50_75974_c1
289 nmdc:mga0rr50_994906_c1
290 nmdc:mga08x19_6_c2
291 nmdc:mga0a205_46048_c1
292 nmdc:mga0a205_894505_c1
293 nmdc:mga0sz30_100026_c1
294 nmdc:mga0sz30_33700_c1
295 nmdc:mga0sz30_52904_c1
296 Ga0500644_0001070
297 Ga0500644_0267249
298 Ga0500583_0000137
299 Ga0500583_0255514
300 Ga0500628_000944
301 Ga0500642_0097647
302 Ga0500577_0000696
303 Ga0500589_000016
304 Ga0500616_0295250
305 Ga0500637_0319617
306 Ga0500570_000001
307 Ga0500611_000544
308 Ga0590071_000338
309 Ga0590074_001667
310 Ga0590075_000622
311 Ga0590077_001669
312 Ga0587082_032155
313 2753072997
314 2862392852
315 2863412464
316 8008565806

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

152

0.92

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

25

153

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8995 1 134
1u6l-assembly1.cif.gz_B crystal structure of protein pa1353 from pseudomonas aeruginosa 0.8867 1 134
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8213 2 133
3oms-assembly1.cif.gz_A-2 putative 3-demethylubiquinone-9 3-methyltransferase, phnb protein, from bacillus cereus. 0.8157 2 133
3l20-assembly1.cif.gz_B crystal structure of a hypothetical protein from staphylococcus aureus 0.7855 1 134
ID Description Score Start End Superfamily
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8871 8 134 3.10.180.10
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8764 77 132 3.30.720.110
1u6lB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8733 8 134 3.10.180.10
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8679 72 133 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8539 72 133 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A0S9D7Q1-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9931 1 134 GO:0008168
GO:0032259
AF-A0A0K8QIJ1-F1-model_v4 Protein PhnB 0.9903 1 135
AF-A0A7W8ZV94-F1-model_v4 PhnB protein 0.9898 1 135
AF-A0A3N5LER3-F1-model_v4 VOC family protein 0.9877 11 137
AF-A0JWK3-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase 0.9861 1 137 GO:0008168
GO:0032259

Map