F229576

General Info

Members Datasets Scaffolds Average Seq Length
158 106 316 306

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10891871|Ga0114129_108918712
Length 325
Sequence LRAALQPVKIARKKAERGDIVSSMDTLTQAPSGTQWTIEAGGQRAVVVEVGGGIREFGAVVFGYDADQICPNSAGKILAPWPNRIRDGQYTFGGDTYQLALTEPARHNAIHGLVNWSRWRHVESTGDSVTVEHHLVPQSGYPWPVTLRTTWSIGPGGLTATHTATNTGTVPCPFGLGAHPYVRVPGVAVDDLRLRIPAASRLLVDGRSLPIGAAKVASTEYDFTAPRALGATQLDHGFGDLERDVGGGSAVTLEAPDGRGVRVWADAAFHWWQVFTGDSLAPARARKSVAVEPMTCPPDAFRSGRDLLTIEPGQTWRGSWGIQEF

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
25 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
49 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
52 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
53 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
54 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
59 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
60 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
61 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
64 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
67 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
76 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
83 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
84 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
85 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
86 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
87 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
88 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
89 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
90 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
91 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
92 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
93 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
94 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
95 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
96 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
97 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
98 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
99 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
100 2858868258 Micromonospora sp. MH33 Isolate Unclassified
101 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
102 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
103 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
104 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
105 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
106 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.04
Metatranscriptomes 0
Isolates 6.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0.63
Rhizoplane 6.33
Rhizosphere 68.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10891871 3300009147 Bacteria 1127
2 JGI25406J46586_10026461 3300003203 Bacteria 2235
3 JGI25406J46586_10035063 3300003203 Bacteria 1835
4 rootL2_10074833 3300003322 Bacteria 1714
5 Ga0070668_100000183 3300005347 Bacteria 40650
6 Ga0070668_100025037 3300005347 Bacteria 4523
7 Ga0070671_100291484 3300005355 Bacteria 1389
8 Ga0070667_100027754 3300005367 Bacteria 4710
9 Ga0070699_100167086 3300005518 Bacteria 1949
10 Ga0070684_100131039 3300005535 Bacteria 2262
11 Ga0070665_100199813 3300005548 Bacteria 2000
12 Ga0070664_100172403 3300005564 Bacteria 1919
13 Ga0068856_100503982 3300005614 Bacteria 1232
14 Ga0068864_100004691 3300005618 Bacteria 11214
15 Ga0068864_100021576 3300005618 Bacteria 5394
16 Ga0068864_100144935 3300005618 Bacteria 2146
17 Ga0068864_100243713 3300005618 Bacteria 1666
18 Ga0068861_100433431 3300005719 Bacteria 1174
19 Ga0068863_100041829 3300005841 Bacteria 4357
20 Ga0068863_100044352 3300005841 Bacteria 4221
21 Ga0081455_10070066 3300005937 Bacteria 2912
22 Ga0081540_1012089 3300005983 Bacteria 5711
23 Ga0081539_10000205 3300005985 Bacteria 137262
24 Ga0081539_10003816 3300005985 Bacteria 17715
25 Ga0081539_10005095 3300005985 Bacteria 13762
26 Ga0081539_10008555 3300005985 Bacteria 8857
27 Ga0081539_10009590 3300005985 Bacteria 8046
28 Ga0075428_100073555 3300006844 Bacteria 3733
29 Ga0075428_100082755 3300006844 Bacteria 3502
30 Ga0075428_100253066 3300006844 Bacteria 1898
31 Ga0075433_10065730 3300006852 Bacteria 3181
32 Ga0075434_100709694 3300006871 Bacteria 1023
33 Ga0105247_10040962 3300009101 Bacteria 2833
34 Ga0114129_10317785 3300009147 Bacteria 2071
35 Ga0114129_10413192 3300009147 Bacteria 1776
36 Ga0105248_10009087 3300009177 Bacteria 10930
37 Ga0105248_10078160 3300009177 Bacteria 3721
38 Ga0163163_10091695 3300014325 Bacteria 3053
39 Ga0163163_10114374 3300014325 Bacteria 2729
40 Ga0163163_10131405 3300014325 Bacteria 2544
41 Ga0157379_10028891 3300014968 Bacteria 4932
42 Ga0157379_10090956 3300014968 Bacteria 2738
43 Ga0157379_10374016 3300014968 Bacteria 1307
44 Ga0207699_10126901 3300025906 Bacteria 1658
45 Ga0207699_10215184 3300025906 Bacteria 1309
46 Ga0207652_10135750 3300025921 Bacteria 2197
47 Ga0207644_10261032 3300025931 Bacteria 1385
48 Ga0207665_10212470 3300025939 Bacteria 1414
49 Ga0207711_10052464 3300025941 Bacteria 3495
50 Ga0207679_10047751 3300025945 Bacteria 3113
51 Ga0207668_10000831 3300025972 Bacteria 18686
52 Ga0207668_10015563 3300025972 Bacteria 4728
53 Ga0207658_10016724 3300025986 Bacteria 5049
54 Ga0207703_10004905 3300026035 Bacteria 10875
55 Ga0207678_10246594 3300026067 Bacteria 1530
56 Ga0207702_10491488 3300026078 Bacteria 1195
57 Ga0207641_10072108 3300026088 Bacteria 2974
58 Ga0207641_10072245 3300026088 Bacteria 2971
59 Ga0207641_10311219 3300026088 Bacteria 1490
60 Ga0207676_10044335 3300026095 Bacteria 3431
61 Ga0207676_10075828 3300026095 Bacteria 2715
62 Ga0207676_10106477 3300026095 Bacteria 2337
63 Ga0207674_10034222 3300026116 Bacteria 5314
64 Ga0207674_10153390 3300026116 Bacteria 2260
65 Ga0268266_10121987 3300028379 Bacteria 2320
66 Ga0268266_10360650 3300028379 Bacteria 1368
67 Ga0268265_10060721 3300028380 Bacteria 2898
68 Ga0268264_10039973 3300028381 Bacteria 3875
69 Ga0307515_10000379 3300028794 Bacteria 108548
70 Ga0307515_10005159 3300028794 Bacteria 26553
71 Ga0307515_10020632 3300028794 Bacteria 11738
72 Ga0307515_10064385 3300028794 Bacteria 5126
73 Ga0307515_10079343 3300028794 Bacteria 4301
74 Ga0307512_10002142 3300030522 Bacteria 25854
75 Ga0307512_10003334 3300030522 Bacteria 18844
76 Ga0307513_10002467 3300031456 Bacteria 25604
77 Ga0307513_10009749 3300031456 Bacteria 12129
78 Ga0307509_10004994 3300031507 Bacteria 18718
79 Ga0307509_10050229 3300031507 Bacteria 4467
80 Ga0307509_10365017 3300031507 Bacteria 1162
81 Ga0307508_10000914 3300031616 Bacteria 34391
82 Ga0307508_10087118 3300031616 Bacteria 2707
83 Ga0307516_10001135 3300031730 Bacteria 37117
84 Ga0307516_10088147 3300031730 Bacteria 2936
85 Ga0307516_10123587 3300031730 Bacteria 2375
86 Ga0307516_10325394 3300031730 Bacteria 1207
87 Ga0307413_10288153 3300031824 Bacteria 1239
88 Ga0326468_10000067 3300031889 Bacteria 8492
89 Ga0307406_10010400 3300031901 Bacteria 5246
90 Ga0307406_10047834 3300031901 Bacteria 2698
91 Ga0307406_10261122 3300031901 Bacteria 1310
92 Ga0307407_10053777 3300031903 Bacteria 2318
93 Ga0307409_100015727 3300031995 Bacteria 4978
94 Ga0307409_100099758 3300031995 Bacteria 2405
95 Ga0307416_100034866 3300032002 Bacteria 3836
96 Ga0307416_100035439 3300032002 Bacteria 3811
97 Ga0307416_100053489 3300032002 Bacteria 3240
98 Ga0307416_100087891 3300032002 Bacteria 2655
99 Ga0307414_10058839 3300032004 Bacteria 2710
100 Ga0307411_10049411 3300032005 Bacteria 2733
101 Ga0307415_100011176 3300032126 Bacteria 5123
102 Ga0307415_100053090 3300032126 Bacteria 2760
103 Ga0307415_100221267 3300032126 Bacteria 1518
104 Ga0307507_10042802 3300033179 Bacteria 4504
105 Ga0373950_0009213 3300034818 Bacteria 1570
106 Ga0373938_0001995 3300034957 Bacteria 3271
107 Ga0373940_0002256 3300035088 Bacteria 3712
108 Ga0373951_0000188 3300035091 Bacteria 22431
109 Ga0373942_0000142 3300035207 Bacteria 17062
110 Ga0373962_0011535 3300035242 Bacteria 2216
111 Ga0373924_0027217 3300035410 Bacteria 2273
112 Ga0373935_0038616 3300035692 Bacteria 2990
113 Ga0395899_0058203 3300037312 Bacteria 2851
114 Ga0395898_0011157 3300037466 Bacteria 9356
115 Ga0395905_0091028 3300037471 Bacteria 2860
116 Ga0395901_0016431 3300038443 Bacteria 7538
117 Ga0451853_0067848 3300041512 Bacteria 6015
118 Ga0495629_0034780 3300046459 Bacteria 3562
119 Ga0495662_0165626 3300046476 Bacteria 1089
120 Ga0495594_0084001 3300046499 Bacteria 1780
121 Ga0495635_0189960 3300046663 Bacteria 1395
122 Ga0496104_0134067 3300048907 Bacteria 2379
123 Ga0496105_0017199 3300048908 Bacteria 5792
124 Ga0496108_0000323 3300048911 Bacteria 40586
125 Ga0496108_0006496 3300048911 Bacteria 9485
126 Ga0496109_0128029 3300048912 Bacteria 2368
127 Ga0496111_0013164 3300048914 Bacteria 5623
128 Ga0496112_0043793 3300048915 Bacteria 4382
129 Ga0496112_0055005 3300048915 Bacteria 3911
130 Ga0496112_0313535 3300048915 Bacteria 1513
131 Ga0496113_0002025 3300048916 Bacteria 11636
132 Ga0501040_0081353 3300049576 Bacteria 2245
133 nmdc:mga00v17_126409_c1 3300050491 Bacteria 1631
134 nmdc:mga05p37_281977_c1 3300050507 Bacteria 1981
135 nmdc:mga0a205_21278_c1 3300050515 Bacteria 6134
136 Ga0495619_0031269 3300053085 Bacteria 3449
137 Ga0500644_0080411 3300053088 Bacteria 1197
138 Ga0500646_0000441 3300053090 Bacteria 12323
139 Ga0500646_0065516 3300053090 Bacteria 1079
140 Ga0500641_0004165 3300053096 Bacteria 5105
141 Ga0500641_0018936 3300053096 Bacteria 2597
142 Ga0500650_0070240 3300053098 Bacteria 1637
143 Ga0500652_093816 3300053131 Bacteria 1253
144 Ga0500579_032872 3300053143 Bacteria 3319
145 Ga0500588_0000670 3300053146 Bacteria 5730
146 Ga0501082_0544282 3300060353 Bacteria 1015
147 Ga0530510_0107828 3300061734 Bacteria 2039
148 2515494071 2515154088 Bacteria 5526283
149 2753269542 2751185782 Bacteria 11227053
150 2831937261 2831935698 Bacteria 5963223
151 2832006607 2832004796 Bacteria 6538017
152 2858872871 2858868258 Bacteria 7683772
153 2861525446 2861520306 Bacteria 8348283
154 2866065718 2866065130 Bacteria 6518152
155 2867304182 2867302475 Bacteria 7087181
156 2867509191 2867507094 Bacteria 6506033
157 8055414142 8055412473 Bacteria 6257500
158 8057574180 8057568493 Bacteria 7221719
159 Ga0114129_10891871
160 JGI25406J46586_10026461
161 JGI25406J46586_10035063
162 rootL2_10074833
163 Ga0070668_100000183
164 Ga0070668_100025037
165 Ga0070671_100291484
166 Ga0070667_100027754
167 Ga0070699_100167086
168 Ga0070684_100131039
169 Ga0070665_100199813
170 Ga0070664_100172403
171 Ga0068856_100503982
172 Ga0068864_100004691
173 Ga0068864_100021576
174 Ga0068864_100144935
175 Ga0068864_100243713
176 Ga0068861_100433431
177 Ga0068863_100041829
178 Ga0068863_100044352
179 Ga0081455_10070066
180 Ga0081540_1012089
181 Ga0081539_10000205
182 Ga0081539_10003816
183 Ga0081539_10005095
184 Ga0081539_10008555
185 Ga0081539_10009590
186 Ga0075428_100073555
187 Ga0075428_100082755
188 Ga0075428_100253066
189 Ga0075433_10065730
190 Ga0075434_100709694
191 Ga0105247_10040962
192 Ga0114129_10317785
193 Ga0114129_10413192
194 Ga0105248_10009087
195 Ga0105248_10078160
196 Ga0163163_10091695
197 Ga0163163_10114374
198 Ga0163163_10131405
199 Ga0157379_10028891
200 Ga0157379_10090956
201 Ga0157379_10374016
202 Ga0207699_10126901
203 Ga0207699_10215184
204 Ga0207652_10135750
205 Ga0207644_10261032
206 Ga0207665_10212470
207 Ga0207711_10052464
208 Ga0207679_10047751
209 Ga0207668_10000831
210 Ga0207668_10015563
211 Ga0207658_10016724
212 Ga0207703_10004905
213 Ga0207678_10246594
214 Ga0207702_10491488
215 Ga0207641_10072108
216 Ga0207641_10072245
217 Ga0207641_10311219
218 Ga0207676_10044335
219 Ga0207676_10075828
220 Ga0207676_10106477
221 Ga0207674_10034222
222 Ga0207674_10153390
223 Ga0268266_10121987
224 Ga0268266_10360650
225 Ga0268265_10060721
226 Ga0268264_10039973
227 Ga0307515_10000379
228 Ga0307515_10005159
229 Ga0307515_10020632
230 Ga0307515_10064385
231 Ga0307515_10079343
232 Ga0307512_10002142
233 Ga0307512_10003334
234 Ga0307513_10002467
235 Ga0307513_10009749
236 Ga0307509_10004994
237 Ga0307509_10050229
238 Ga0307509_10365017
239 Ga0307508_10000914
240 Ga0307508_10087118
241 Ga0307516_10001135
242 Ga0307516_10088147
243 Ga0307516_10123587
244 Ga0307516_10325394
245 Ga0307413_10288153
246 Ga0326468_10000067
247 Ga0307406_10010400
248 Ga0307406_10047834
249 Ga0307406_10261122
250 Ga0307407_10053777
251 Ga0307409_100015727
252 Ga0307409_100099758
253 Ga0307416_100034866
254 Ga0307416_100035439
255 Ga0307416_100053489
256 Ga0307416_100087891
257 Ga0307414_10058839
258 Ga0307411_10049411
259 Ga0307415_100011176
260 Ga0307415_100053090
261 Ga0307415_100221267
262 Ga0307507_10042802
263 Ga0373950_0009213
264 Ga0373938_0001995
265 Ga0373940_0002256
266 Ga0373951_0000188
267 Ga0373942_0000142
268 Ga0373962_0011535
269 Ga0373924_0027217
270 Ga0373935_0038616
271 Ga0395899_0058203
272 Ga0395898_0011157
273 Ga0395905_0091028
274 Ga0395901_0016431
275 Ga0451853_0067848
276 Ga0495629_0034780
277 Ga0495662_0165626
278 Ga0495594_0084001
279 Ga0495635_0189960
280 Ga0496104_0134067
281 Ga0496105_0017199
282 Ga0496108_0000323
283 Ga0496108_0006496
284 Ga0496109_0128029
285 Ga0496111_0013164
286 Ga0496112_0043793
287 Ga0496112_0055005
288 Ga0496112_0313535
289 Ga0496113_0002025
290 Ga0501040_0081353
291 nmdc:mga00v17_126409_c1
292 nmdc:mga05p37_281977_c1
293 nmdc:mga0a205_21278_c1
294 Ga0495619_0031269
295 Ga0500644_0080411
296 Ga0500646_0000441
297 Ga0500646_0065516
298 Ga0500641_0004165
299 Ga0500641_0018936
300 Ga0500650_0070240
301 Ga0500652_093816
302 Ga0500579_032872
303 Ga0500588_0000670
304 Ga0501082_0544282
305 Ga0530510_0107828
306 2515494071
307 2753269542
308 2831937261
309 2832006607
310 2858872871
311 2861525446
312 2866065718
313 2867304182
314 2867509191
315 8055414142
316 8057574180

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

34

323

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.8865 11 303
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.876 11 304
1so0-assembly4.cif.gz_D crystal structure of human galactose mutarotase complexed with galactose 0.8721 7 304
3os7-assembly4.cif.gz_D crystal structure of a galactose mutarotase-like protein (ca_c0697) from clostridium acetobutylicum at 1.80 a resolution 0.8678 12 303
4rnl-assembly1.cif.gz_A the crystal structure of a possible galactose mutarotase from streptomyces platensis subsp. rosaceus 0.8669 12 304
ID Description Score Start End Superfamily
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9588 11 303 2.70.98.10
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9522 11 303 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8903 9 304 2.70.98.10
af_P76584_1_290_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8846 11 304 2.70.98.10
1lurA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8761 11 303 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A1C6TS51-F1-model_v4 Aldose 1-epimerase 0.9935 28 305 GO:0005975
GO:0016853
GO:0030246
AF-A0A6F8YK78-F1-model_v4 Aldose 1-epimerase 0.9916 9 305 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A2X4U5Y7-F1-model_v4 Aldose-1-epimerase 0.9879 59 155 GO:0005975
GO:0016853
GO:0030246
AF-A0A841FU36-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9848 9 305 GO:0005975
GO:0016853
GO:0030246
AF-A0A540VX92-F1-model_v4 Aldose 1-epimerase family protein 0.9842 9 305 GO:0004034
GO:0006006
GO:0030246
GO:0033499

Map