F228372

General Info

Members Datasets Scaffolds Average Seq Length
157 114 154 240

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_148370_c1|nmdc:mga0k408_148370_c1_547_1377
Length 276
Sequence MRSDGTCGFWARHQASAMPIAVVTGANRGLGLETASVLAGRGYRVWLTGRNGAHAERAAAGLREQKLDVQAAVLDVASAESVAAFAQRVAGEPVIDALVNNAGTTLPGFDTQVAQTTVDNNYRGAVRVTDALLGRLSARANVVMVSSGMGELSRFSPELRRRLLSPTLSRAEIEAIAEEFVSAVKRDSPGVAGFPSNAYSVSKALMNAFTRVLARDFTGTGRHINAVCPGWVKTRMGGSSAPRSLERGASGIVWAATLGTDGPNGGFFRDGKPIDW

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
3 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
46 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
47 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
48 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
57 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
58 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
71 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
72 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
82 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 0
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.55
Nodule 1.27
Rhizoplane 3.18
Rhizosphere 85.99
Stem 0
Stem Tuber 0
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10058613 3300003316 Bacteria 3098
2 rootH1_10058613 3300003323 Bacteria 8666
3 Ga0070666_10182773 3300005335 Bacteria 1471
4 Ga0070682_100003910 3300005337 Bacteria 8266
5 Ga0070682_100004244 3300005337 Bacteria 7953
6 Ga0070682_100035363 3300005337 Bacteria 3050
7 Ga0070692_10522290 3300005345 Bacteria 773
8 Ga0070675_100173836 3300005354 Bacteria 1859
9 Ga0070671_100232794 3300005355 Bacteria 1563
10 Ga0070673_100102549 3300005364 Unclassified 2359
11 Ga0070698_100526769 3300005471 Bacteria 1120
12 Ga0070672_100006449 3300005543 Bacteria 7885
13 Ga0070665_100048801 3300005548 Bacteria 4249
14 Ga0070704_101074021 3300005549 Bacteria 730
15 Ga0068855_100003809 3300005563 Bacteria 18444
16 Ga0070664_100156688 3300005564 Bacteria 2013
17 Ga0068856_100016883 3300005614 Bacteria 7075
18 Ga0068852_100305462 3300005616 Bacteria 1541
19 Ga0068851_10240179 3300005834 Bacteria 1024
20 Ga0068851_10407455 3300005834 Bacteria 801
21 Ga0068863_100089170 3300005841 Bacteria 2924
22 Ga0075366_10075051 3300006195 Bacteria 2017
23 Ga0075366_10119656 3300006195 Bacteria 1587
24 Ga0075428_100000059 3300006844 Bacteria 88972
25 Ga0075428_100017442 3300006844 Bacteria 7936
26 Ga0075428_100070633 3300006844 Bacteria 3817
27 Ga0075430_100003283 3300006846 Bacteria 13560
28 Ga0075430_100044233 3300006846 Bacteria 3767
29 Ga0075431_100002206 3300006847 Bacteria 18649
30 Ga0075431_100015106 3300006847 Bacteria 7820
31 Ga0075433_10000812 3300006852 Bacteria 21706
32 Ga0075429_100069095 3300006880 Bacteria 3076
33 Ga0075429_100313429 3300006880 Bacteria 1373
34 Ga0111539_10000222 3300009094 Bacteria 68456
35 Ga0111539_10007622 3300009094 Bacteria 13831
36 Ga0105248_10185884 3300009177 Bacteria 2341
37 Ga0105248_11044571 3300009177 Bacteria 923
38 Ga0105238_10635899 3300009551 Bacteria 1076
39 Ga0105239_10633587 3300010375 Bacteria 1221
40 Ga0157376_10195410 3300014969 Unclassified 1858
41 Ga0157376_10235623 3300014969 Bacteria 1703
42 Ga0207646_10371069 3300025922 Unclassified 1293
43 Ga0207687_10003308 3300025927 Bacteria 10890
44 Ga0207644_10254190 3300025931 Bacteria 1403
45 Ga0207691_10005418 3300025940 Bacteria 12312
46 Ga0207711_10079354 3300025941 Bacteria 2865
47 Ga0207679_10130144 3300025945 Bacteria 2018
48 Ga0207667_10018751 3300025949 Bacteria 7749
49 Ga0207639_10710812 3300026041 Bacteria 933
50 Ga0207641_10173897 3300026088 Bacteria 1968
51 Ga0207698_10412314 3300026142 Bacteria 1294
52 Ga0207428_10003977 3300027907 Bacteria 14178
53 Ga0268266_10004415 3300028379 Bacteria 13477
54 Ga0265337_1034739 3300028556 Bacteria 1481
55 Ga0265334_10018593 3300028573 Bacteria 2864
56 Ga0265318_10044433 3300028577 Bacteria 1681
57 Ga0265323_10010985 3300028653 Unclassified 3662
58 Ga0265322_10002892 3300028654 Bacteria 5234
59 Ga0265338_10001269 3300028800 Bacteria 41609
60 Ga0265338_10025511 3300028800 Bacteria 5995
61 Ga0265338_10044702 3300028800 Bacteria 4084
62 Ga0265325_10008707 3300031241 Bacteria 5967
63 Ga0265340_10028996 3300031247 Bacteria 2781
64 Ga0265339_10068112 3300031249 Bacteria 1903
65 Ga0265316_10017937 3300031344 Bacteria 6102
66 Ga0307513_10160126 3300031456 Bacteria 2145
67 Ga0307408_100076907 3300031548 Bacteria 2484
68 Ga0265313_10020681 3300031595 Bacteria 3623
69 Ga0265313_10020809 3300031595 Bacteria 3607
70 Ga0265313_10025596 3300031595 Bacteria 3121
71 Ga0265313_10111007 3300031595 Bacteria 1206
72 Ga0265313_10126956 3300031595 Bacteria 1108
73 Ga0265314_10097010 3300031711 Bacteria 1905
74 Ga0265314_10313690 3300031711 Bacteria 875
75 Ga0265342_10008539 3300031712 Bacteria 7328
76 Ga0265342_10063565 3300031712 Bacteria 2169
77 Ga0307413_10034612 3300031824 Bacteria 2889
78 Ga0307410_10126020 3300031852 Bacteria 1875
79 Ga0307407_10167799 3300031903 Bacteria 1443
80 Ga0307412_10441791 3300031911 Bacteria 1069
81 Ga0307412_10763503 3300031911 Bacteria 836
82 Ga0307409_100084011 3300031995 Bacteria 2584
83 Ga0307409_100366334 3300031995 Bacteria 1365
84 Ga0307416_100259797 3300032002 Bacteria 1697
85 Ga0307416_100957049 3300032002 Bacteria 958
86 Ga0307414_10124331 3300032004 Bacteria 1990
87 Ga0307411_10079919 3300032005 Bacteria 2247
88 Ga0307415_100657320 3300032126 Bacteria 940
89 Ga0373931_0007715 3300035691 Bacteria 5081
90 Ga0373937_0034315 3300036401 Bacteria 4615
91 Ga0373937_0091215 3300036401 Bacteria 2823
92 Ga0400488_49601 3300038741 Bacteria 3539
93 Ga0400483_042110 3300039062 Bacteria 2190
94 Ga0400483_050565 3300039062 Bacteria 16030
95 Ga0400483_091340 3300039062 Bacteria 4030
96 Ga0400483_220300 3300039062 Bacteria 18032
97 Ga0400483_243316 3300039062 Bacteria 3756
98 Ga0400483_288981 3300039062 Bacteria 1642
99 Ga0466969_0003873 3300044656 Bacteria 7941
100 Ga0466972_0026896 3300044658 Bacteria 2850
101 Ga0466966_0013504 3300044684 Bacteria 5407
102 Ga0453684_0115020 3300044712 Bacteria 3260
103 Ga0451576_0440136 3300045051 Unclassified 1368
104 Ga0495629_0079416 3300046459 Bacteria 2291
105 Ga0495653_0011701 3300046463 Bacteria 7161
106 Ga0495608_0005293 3300046511 Bacteria 9219
107 Ga0495618_0124800 3300046514 Bacteria 1648
108 Ga0495646_0006425 3300046680 Bacteria 7452
109 Ga0495658_0037183 3300046683 Bacteria 2690
110 Ga0495658_0127970 3300046683 Bacteria 1543
111 Ga0495658_0308787 3300046683 Bacteria 1001
112 Ga0495624_0004328 3300046690 Bacteria 10414
113 Ga0495600_0121206 3300046809 Bacteria 1701
114 Ga0495581_0039497 3300047315 Unclassified 2732
115 Ga0495604_0033653 3300047317 Bacteria 4055
116 Ga0495674_0014125 3300047319 Bacteria 7480
117 Ga0495676_0013850 3300047321 Bacteria 7231
118 Ga0496101_0365887 3300048904 Bacteria 1134
119 Ga0496106_0057564 3300048909 Bacteria 2940
120 Ga0496108_0275755 3300048911 Bacteria 1464
121 Ga0496110_0278194 3300048913 Bacteria 1524
122 Ga0496114_0010920 3300048917 Bacteria 7239
123 Ga0501034_0000710 3300049571 Bacteria 50578
124 Ga0501034_0016543 3300049571 Bacteria 7562
125 Ga0501034_0043284 3300049571 Bacteria 4558
126 Ga0501040_0461302 3300049576 Bacteria 915
127 Ga0501042_0309087 3300049578 Bacteria 1142
128 Ga0501043_0514000 3300049579 Bacteria 893
129 Ga0501047_0328611 3300049581 Bacteria 1368
130 Ga0501067_0010522 3300049583 Bacteria 5123
131 Ga0501067_0059808 3300049583 Bacteria 2109
132 Ga0501073_0097583 3300049589 Bacteria 2041
133 Ga0501076_0196039 3300049592 Bacteria 1649
134 Ga0501076_0319028 3300049592 Bacteria 1275
135 Ga0501076_0357924 3300049592 Bacteria 1199
136 Ga0501080_0024762 3300049742 Bacteria 5567
137 Ga0501083_0001602 3300049744 Bacteria 15469
138 Ga0501083_0013790 3300049744 Bacteria 5650
139 Ga0501083_0108652 3300049744 Bacteria 1824
140 Ga0501083_0314972 3300049744 Bacteria 1018
141 Ga0501035_0127755 3300049822 Bacteria 2218
142 Ga0501035_0256459 3300049822 Bacteria 1484
143 Ga0501044_0330419 3300049823 Bacteria 1447
144 nmdc:mga0k408_148370_c1 3300050493 Bacteria 1396
145 nmdc:mga0qj67_2925_c1 3300050509 Bacteria 12259
146 nmdc:mga06r32_2698_c1 3300050510 Bacteria 15873
147 nmdc:mga08y16_839_c1 3300050511 Bacteria 29468
148 nmdc:mga0a205_310377_c1 3300050515 Unclassified 1088
149 nmdc:mga0a205_90_c1 3300050515 Bacteria 50765
150 Ga0500635_0054960 3300053080 Bacteria 1374
151 Ga0501084_0020346 3300054114 Bacteria 5533
152 Ga0501082_0016195 3300060353 Bacteria 6417
153 Ga0501082_0159320 3300060353 Bacteria 1961
154 Ga0501082_0190929 3300060353 Bacteria 1782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039062 Ga0400483_042110 Ga0400483_042110_346_1059 198
2 3300039062 Ga0400483_091340 Ga0400483_091340_1011_1724 205
3 3300039062 Ga0400483_243316 Ga0400483_243316_399_1112 205
4 3300048904 Ga0496101_0365887 Ga0496101_0365887_240_950 205
5 3300048909 Ga0496106_0057564 Ga0496106_0057564_1225_1935 205
6 3300048911 Ga0496108_0275755 Ga0496108_0275755_89_799 205
7 3300048913 Ga0496110_0278194 Ga0496110_0278194_325_1035 205
8 3300048917 Ga0496114_0010920 Ga0496114_0010920_924_1634 205
9 3300036401 Ga0373937_0091215 Ga0373937_0091215_1810_2517 208
10 3300046514 Ga0495618_0124800 Ga0495618_0124800_714_1421 208
11 3300028573 Ga0265334_10018593 Ga0265334_100185934 210
12 3300028800 Ga0265338_10044702 Ga0265338_100447025 210
13 3300031595 Ga0265313_10126956 Ga0265313_101269562 210
14 3300035691 Ga0373931_0007715 Ga0373931_0007715_590_1264 211
15 3300006852 Ga0075433_10000812 Ga0075433_100008129 213
16 3300050515 nmdc:mga0a205_90_c1 nmdc:mga0a205_90_c1_9631_10311 213
17 3300006844 Ga0075428_100017442 Ga0075428_1000174423 214
18 3300049822 Ga0501035_0256459 Ga0501035_0256459_295_966 214
19 3300044712 Ga0453684_0115020 Ga0453684_0115020_1089_1793 216
20 3300031911 Ga0307412_10763503 Ga0307412_107635031 217
21 3300049579 Ga0501043_0514000 Ga0501043_0514000_128_814 217
22 3300049822 Ga0501035_0127755 Ga0501035_0127755_24_710 217
23 3300049823 Ga0501044_0330419 Ga0501044_0330419_706_1392 217
24 3300005616 Ga0068852_100305462 Ga0068852_1003054622 218
25 3300005834 Ga0068851_10407455 Ga0068851_104074552 218
26 3300026142 Ga0207698_10412314 Ga0207698_104123142 218
27 iso_pu_bacteria 2558860280 2559426157 218
28 iso_pu_bacteria 2842324504 2842331146 219
29 iso_pu_bacteria 2842348783 2842355485 219
30 3300005335 Ga0070666_10182773 Ga0070666_101827732 221
31 3300005345 Ga0070692_10522290 Ga0070692_105222901 221
32 3300005354 Ga0070675_100173836 Ga0070675_1001738361 221
33 3300005355 Ga0070671_100232794 Ga0070671_1002327941 221
34 3300005548 Ga0070665_100048801 Ga0070665_1000488012 221
35 3300005549 Ga0070704_101074021 Ga0070704_1010740211 221
36 3300005564 Ga0070664_100156688 Ga0070664_1001566883 221
37 3300005834 Ga0068851_10240179 Ga0068851_102401792 221
38 3300006844 Ga0075428_100000059 Ga0075428_10000005957 221
39 3300006846 Ga0075430_100003283 Ga0075430_1000032838 221
40 3300006847 Ga0075431_100015106 Ga0075431_1000151066 221
41 3300006880 Ga0075429_100313429 Ga0075429_1003134291 221
42 3300009094 Ga0111539_10000222 Ga0111539_1000022232 221
43 3300009177 Ga0105248_10185884 Ga0105248_101858844 221
44 3300009177 Ga0105248_11044571 Ga0105248_110445712 221
45 3300025931 Ga0207644_10254190 Ga0207644_102541901 221
46 3300025941 Ga0207711_10079354 Ga0207711_100793542 221
47 3300025945 Ga0207679_10130144 Ga0207679_101301443 221
48 3300026041 Ga0207639_10710812 Ga0207639_107108121 221
49 3300027907 Ga0207428_10003977 Ga0207428_100039778 221
50 3300028379 Ga0268266_10004415 Ga0268266_100044152 221
51 3300036401 Ga0373937_0034315 Ga0373937_0034315_1453_2142 221
52 3300046459 Ga0495629_0079416 Ga0495629_0079416_1239_1958 221
53 3300046683 Ga0495658_0037183 Ga0495658_0037183_129_818 221
54 3300046683 Ga0495658_0127970 Ga0495658_0127970_452_1141 221
55 3300046683 Ga0495658_0308787 Ga0495658_0308787_36_737 221
56 3300046809 Ga0495600_0121206 Ga0495600_0121206_415_1104 221
57 3300049571 Ga0501034_0000710 Ga0501034_0000710_9838_10527 221
58 3300049571 Ga0501034_0016543 Ga0501034_0016543_3302_4006 221
59 3300049744 Ga0501083_0013790 Ga0501083_0013790_1619_2311 221
60 3300050509 nmdc:mga0qj67_2925_c1 nmdc:mga0qj67_2925_c1_4792_5481 221
61 3300050511 nmdc:mga08y16_839_c1 nmdc:mga08y16_839_c1_15975_16667 221
62 iso_pu_bacteria 639633007 639787606 221
63 3300005471 Ga0070698_100526769 Ga0070698_1005267691 222
64 3300006844 Ga0075428_100070633 Ga0075428_1000706332 222
65 3300006846 Ga0075430_100044233 Ga0075430_1000442334 222
66 3300006847 Ga0075431_100002206 Ga0075431_1000022068 222
67 3300006880 Ga0075429_100069095 Ga0075429_1000690953 222
68 3300028556 Ga0265337_1034739 Ga0265337_10347391 222
69 3300028653 Ga0265323_10010985 Ga0265323_100109852 222
70 3300028654 Ga0265322_10002892 Ga0265322_100028925 222
71 3300028800 Ga0265338_10001269 Ga0265338_100012695 222
72 3300028800 Ga0265338_10025511 Ga0265338_100255114 222
73 3300031548 Ga0307408_100076907 Ga0307408_1000769072 222
74 3300031824 Ga0307413_10034612 Ga0307413_100346125 222
75 3300031852 Ga0307410_10126020 Ga0307410_101260202 222
76 3300031903 Ga0307407_10167799 Ga0307407_101677992 222
77 3300031911 Ga0307412_10441791 Ga0307412_104417911 222
78 3300031995 Ga0307409_100084011 Ga0307409_1000840112 222
79 3300031995 Ga0307409_100366334 Ga0307409_1003663342 222
80 3300032002 Ga0307416_100259797 Ga0307416_1002597973 222
81 3300032002 Ga0307416_100957049 Ga0307416_1009570491 222
82 3300032004 Ga0307414_10124331 Ga0307414_101243312 222
83 3300032005 Ga0307411_10079919 Ga0307411_100799192 222
84 3300032126 Ga0307415_100657320 Ga0307415_1006573201 222
85 3300038741 Ga0400488_49601 Ga0400488_49601_1034_1747 222
86 3300039062 Ga0400483_050565 Ga0400483_050565_6811_7524 222
87 3300039062 Ga0400483_220300 Ga0400483_220300_12268_12981 222
88 3300039062 Ga0400483_288981 Ga0400483_288981_175_888 222
89 3300046463 Ga0495653_0011701 Ga0495653_0011701_2909_3613 222
90 3300046511 Ga0495608_0005293 Ga0495608_0005293_2049_2753 222
91 3300046680 Ga0495646_0006425 Ga0495646_0006425_2658_3362 222
92 3300046690 Ga0495624_0004328 Ga0495624_0004328_2340_3044 222
93 3300047315 Ga0495581_0039497 Ga0495581_0039497_1004_1708 222
94 3300047317 Ga0495604_0033653 Ga0495604_0033653_2226_2930 222
95 3300047319 Ga0495674_0014125 Ga0495674_0014125_2658_3362 222
96 3300047321 Ga0495676_0013850 Ga0495676_0013850_4302_5006 222
97 3300049576 Ga0501040_0461302 Ga0501040_0461302_144_854 222
98 3300049592 Ga0501076_0357924 Ga0501076_0357924_262_972 222
99 3300050510 nmdc:mga06r32_2698_c1 nmdc:mga06r32_2698_c1_5762_6472 222
100 3300025922 Ga0207646_10371069 Ga0207646_103710692 237
101 3300044656 Ga0466969_0003873 Ga0466969_0003873_6193_6987 245
102 3300044684 Ga0466966_0013504 Ga0466966_0013504_4525_5319 245
103 3300028577 Ga0265318_10044433 Ga0265318_100444332 253
104 3300031241 Ga0265325_10008707 Ga0265325_100087075 253
105 3300031247 Ga0265340_10028996 Ga0265340_100289962 253
106 3300031249 Ga0265339_10068112 Ga0265339_100681122 253
107 3300031344 Ga0265316_10017937 Ga0265316_100179375 253
108 3300031595 Ga0265313_10020681 Ga0265313_100206814 253
109 3300031595 Ga0265313_10020809 Ga0265313_100208094 253
110 3300031595 Ga0265313_10025596 Ga0265313_100255963 253
111 3300031595 Ga0265313_10111007 Ga0265313_101110072 253
112 3300031711 Ga0265314_10097010 Ga0265314_100970102 253
113 3300031712 Ga0265342_10008539 Ga0265342_100085394 253
114 3300031712 Ga0265342_10063565 Ga0265342_100635652 253
115 3300049571 Ga0501034_0043284 Ga0501034_0043284_1094_1870 253
116 3300049581 Ga0501047_0328611 Ga0501047_0328611_469_1242 253
117 3300049583 Ga0501067_0010522 Ga0501067_0010522_4275_5048 253
118 3300049583 Ga0501067_0059808 Ga0501067_0059808_396_1160 253
119 3300049589 Ga0501073_0097583 Ga0501073_0097583_36_812 253
120 3300049592 Ga0501076_0196039 Ga0501076_0196039_345_1118 253
121 3300049742 Ga0501080_0024762 Ga0501080_0024762_2473_3237 253
122 3300049744 Ga0501083_0001602 Ga0501083_0001602_883_1659 253
123 3300049744 Ga0501083_0108652 Ga0501083_0108652_960_1724 253
124 3300054114 Ga0501084_0020346 Ga0501084_0020346_209_982 253
125 3300060353 Ga0501082_0016195 Ga0501082_0016195_1583_2347 253
126 3300060353 Ga0501082_0159320 Ga0501082_0159320_231_995 253
127 3300060353 Ga0501082_0190929 Ga0501082_0190929_884_1657 253
128 3300005337 Ga0070682_100003910 Ga0070682_1000039105 254
129 3300005337 Ga0070682_100004244 Ga0070682_1000042446 254
130 3300005841 Ga0068863_100089170 Ga0068863_1000891702 254
131 3300006195 Ga0075366_10119656 Ga0075366_101196562 254
132 3300014969 Ga0157376_10235623 Ga0157376_102356232 254
133 3300026088 Ga0207641_10173897 Ga0207641_101738972 254
134 3300045051 Ga0451576_0440136 Ga0451576_0440136_213_977 254
135 3300049578 Ga0501042_0309087 Ga0501042_0309087_276_1040 254
136 3300049592 Ga0501076_0319028 Ga0501076_0319028_158_922 254
137 3300049744 Ga0501083_0314972 Ga0501083_0314972_23_802 254
138 3300031711 Ga0265314_10313690 Ga0265314_103136902 258
139 3300044658 Ga0466972_0026896 Ga0466972_0026896_1905_2696 258
140 3300003323 rootH1_10058613 rootH1_100586138 259
141 3300005337 Ga0070682_100035363 Ga0070682_1000353635 259
142 3300005364 Ga0070673_100102549 Ga0070673_1001025493 259
143 3300005543 Ga0070672_100006449 Ga0070672_1000064497 259
144 3300005563 Ga0068855_100003809 Ga0068855_1000038095 259
145 3300005614 Ga0068856_100016883 Ga0068856_1000168837 259
146 3300006195 Ga0075366_10075051 Ga0075366_100750513 259
147 3300009094 Ga0111539_10007622 Ga0111539_100076224 259
148 3300009551 Ga0105238_10635899 Ga0105238_106358992 259
149 3300010375 Ga0105239_10633587 Ga0105239_106335872 259
150 3300014969 Ga0157376_10195410 Ga0157376_101954103 259
151 3300025927 Ga0207687_10003308 Ga0207687_100033087 259
152 3300025940 Ga0207691_10005418 Ga0207691_100054182 259
153 3300025949 Ga0207667_10018751 Ga0207667_100187516 259
154 3300031456 Ga0307513_10160126 Ga0307513_101601262 259
155 3300050493 nmdc:mga0k408_148370_c1 nmdc:mga0k408_148370_c1_547_1377 259
156 3300050515 nmdc:mga0a205_310377_c1 nmdc:mga0a205_310377_c1_185_967 259
157 3300053080 Ga0500635_0054960 Ga0500635_0054960_138_917 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

19

157

0.94

PF00106

adh_short

short chain dehydrogenase

188

244

0.9

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

168

257

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

25

156

0.86

PF08659

KR

KR domain

20

156

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4z3d-assembly2.cif.gz_C human carbonyl reductase 1 with glutathione in a protective configuration 0.9622 2 259
1n5d-assembly1.cif.gz_A crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase 0.9585 2 259
4z3d-assembly2.cif.gz_C human carbonyl reductase 1 with glutathione in a protective configuration 0.955 2 259
2pfg-assembly1.cif.gz_A crystal structure of human cbr1 in complex with bigf2. 0.9528 1 259
1n5d-assembly1.cif.gz_A crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase 0.9513 2 259
ID Description Score Start End Superfamily
af_K7MUD1_29_120_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9785 2 75 3.40.50.720
1hu4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9585 2 259 3.40.50.720
1hu4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9513 2 259 3.40.50.720
af_K7TY10_36_313_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9492 2 252 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9443 2 56 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A150RA63-F1-model_v4 3-oxoacyl-ACP reductase 0.9844 2 224 GO:0016491
AF-A0A1L9B4H3-F1-model_v4 3-oxoacyl-ACP reductase 0.9775 2 259 GO:0016616
AF-D8SIE0-F1-model_v4 (+)-neomenthol dehydrogenase 0.9717 2 259 GO:0016616
AF-A0A534HTB3-F1-model_v4 SDR family oxidoreductase 0.9716 2 259 GO:0016616
AF-M2W641-F1-model_v4 Carbonyl reductase (NADPH) (EC 1.1.1.184) 0.971 2 257 GO:0004090

Feature Viewer

pLDDT pTM Quality
96.36 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map