F225846

General Info

Members Datasets Scaffolds Average Seq Length
156 116 126 203

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0439550|Ga0501047_0439550_352_1071
Length 239
Sequence VGQHPKDRYHWLGKRENGCFWIKNGRMDLFDNNIDKTKNWLPKDGTVNYYGKLFNRRQADNYLEKLLTTIEWRNDEAVIFGKKIITKRKVAWYGDKPFEYTYSNTTKYALSWTKDLLELKTLIEKETGERFNSCLLNLYHSGEEGMAWHSDGEADLKKDGAIGSLTFGAERKFAFKHKQTKEKVELLLEHGSLLVMKDTTQTFWLHRLPPTKLITKPRVNLTFRTIIHSHKYQAVEGRV

Samples

Sample ID Description Type Environment
1 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
2 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
3 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
4 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
5 2738543023 Pedobacter sp. OK628 Isolate Unclassified
6 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
7 2818991444 Filimonas endophytica 3197 Isolate Unclassified
8 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
9 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
10 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
11 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
12 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
13 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
14 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
15 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
16 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
17 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
18 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
19 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
20 2914759650 Rhizosphaericola mali Isolate Rhizosphere
21 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
22 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
23 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
24 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
25 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
26 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
27 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
45 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
46 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
78 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
79 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
83 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
106 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
107 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
108 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
113 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
114 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
115 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
116 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.77
Metatranscriptomes 0
Isolates 19.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 2.56
Rhizoplane 0
Rhizosphere 80.13
Stem 0
Stem Tuber 0
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10051556 3300003320 Bacteria 1701
2 rootH1_10044637 3300003323 Bacteria 4254
3 Ga0065714_10125415 3300005288 Bacteria 1301
4 Ga0065704_10179569 3300005289 Bacteria 1245
5 Ga0065712_10021797 3300005290 Bacteria 1993
6 Ga0070680_100268350 3300005336 Bacteria 1445
7 Ga0070660_100049297 3300005339 Bacteria 3237
8 Ga0070660_100336510 3300005339 Bacteria 1242
9 Ga0070669_100760693 3300005353 Bacteria 821
10 Ga0070659_100006541 3300005366 Bacteria 8416
11 Ga0070663_100284056 3300005455 Bacteria 1320
12 Ga0070681_10471079 3300005458 Bacteria 1168
13 Ga0070679_100002117 3300005530 Bacteria 17881
14 Ga0070679_100049150 3300005530 Bacteria 4201
15 Ga0070679_100084396 3300005530 Bacteria 3164
16 Ga0070679_100556753 3300005530 Bacteria 1090
17 Ga0068853_100000453 3300005539 Bacteria 27924
18 Ga0068853_100172167 3300005539 Bacteria 1959
19 Ga0068855_100001027 3300005563 Bacteria 34809
20 Ga0068855_100016101 3300005563 Bacteria 8991
21 Ga0068855_100183217 3300005563 Bacteria 2366
22 Ga0068856_100205019 3300005614 Bacteria 1987
23 Ga0068852_100120062 3300005616 Bacteria 2405
24 Ga0079104_1000028 3300006946 Bacteria 208540
25 Ga0105251_10001549 3300009011 Bacteria 19732
26 Ga0105251_10190373 3300009011 Bacteria 924
27 Ga0105244_10028300 3300009036 Bacteria 3008
28 Ga0105244_10037973 3300009036 Bacteria 2514
29 Ga0105244_10100790 3300009036 Bacteria 1413
30 Ga0105250_10005085 3300009092 Bacteria 5943
31 Ga0105240_10000908 3300009093 Bacteria 52921
32 Ga0105240_10090718 3300009093 Bacteria 3734
33 Ga0105240_10627256 3300009093 Unclassified 1181
34 Ga0105237_10012860 3300009545 Bacteria 8798
35 Ga0105249_10000425 3300009553 Bacteria 40270
36 Ga0105249_10021840 3300009553 Bacteria 5731
37 Ga0105239_10001053 3300010375 Bacteria 38389
38 Ga0105239_10016937 3300010375 Bacteria 8056
39 Ga0157373_10013804 3300013100 Bacteria 5922
40 Ga0157371_10003874 3300013102 Bacteria 13340
41 Ga0157371_10025656 3300013102 Bacteria 4292
42 Ga0157371_10026920 3300013102 Bacteria 4174
43 Ga0157370_10001029 3300013104 Bacteria 35080
44 Ga0157370_10362295 3300013104 Bacteria 1336
45 Ga0157369_10266734 3300013105 Bacteria 1785
46 Ga0157372_10012353 3300013307 Bacteria 9100
47 Ga0157372_10319367 3300013307 Unclassified 1808
48 Ga0157375_10043461 3300013308 Bacteria 4359
49 Ga0157380_10268425 3300014326 Bacteria 1554
50 Ga0182006_1035620 3300015261 Bacteria 1983
51 Ga0182006_1035621 3300015261 Bacteria 1983
52 Ga0163161_10791868 3300017792 Bacteria 796
53 Ga0207696_1039635 3300025711 Bacteria 1384
54 Ga0207655_1006651 3300025728 Bacteria 7620
55 Ga0207655_1023865 3300025728 Bacteria 3016
56 Ga0207713_1001800 3300025735 Bacteria 16387
57 Ga0207713_1075203 3300025735 Bacteria 1233
58 Ga0207695_10000462 3300025913 Bacteria 88318
59 Ga0207695_10039860 3300025913 Bacteria 5045
60 Ga0207660_10357439 3300025917 Bacteria 1171
61 Ga0207657_10038730 3300025919 Bacteria 4241
62 Ga0207657_10109061 3300025919 Bacteria 2288
63 Ga0207652_10000482 3300025921 Bacteria 40894
64 Ga0207652_10000621 3300025921 Bacteria 35189
65 Ga0207659_10168651 3300025926 Bacteria 1725
66 Ga0207664_10335007 3300025929 Bacteria 1337
67 Ga0207690_10084849 3300025932 Bacteria 2221
68 Ga0207667_10020033 3300025949 Bacteria 7449
69 Ga0207667_10040005 3300025949 Bacteria 4992
70 Ga0207667_11085342 3300025949 Unclassified 784
71 Ga0207712_10010631 3300025961 Bacteria 5843
72 Ga0207668_10156373 3300025972 Bacteria 1772
73 Ga0207639_10022371 3300026041 Bacteria 4553
74 Ga0207639_10409069 3300026041 Unclassified 1224
75 Ga0207676_11038231 3300026095 Bacteria 809
76 Ga0207674_10238568 3300026116 Bacteria 1765
77 Ga0207698_10109366 3300026142 Bacteria 2312
78 Ga0209281_1000069 3300027111 Bacteria 279747
79 Ga0209489_113976 3300027361 Bacteria 6021
80 Ga0209282_1049152 3300027666 Bacteria 2435
81 Ga0307515_10000001 3300028794 Bacteria 4259510
82 Ga0307515_10159731 3300028794 Bacteria 2306
83 Ga0265327_10005546 3300031251 Bacteria 10483
84 Ga0307408_100000249 3300031548 Bacteria 56039
85 Ga0307406_10001680 3300031901 Bacteria 12168
86 Ga0307407_10032622 3300031903 Bacteria 2833
87 Ga0307412_10443907 3300031911 Unclassified 1067
88 Ga0307416_100000381 3300032002 Bacteria 23018
89 Ga0307414_10000375 3300032004 Bacteria 24537
90 Ga0307414_10015617 3300032004 Bacteria 4587
91 Ga0307414_10038957 3300032004 Bacteria 3197
92 Ga0307411_10032415 3300032005 Bacteria 3228
93 Ga0307415_100210856 3300032126 Bacteria 1550
94 Ga0395899_0003615 3300037312 Bacteria 12229
95 Ga0395899_0079720 3300037312 Bacteria 2384
96 Ga0395900_0014908 3300037418 Bacteria 7919
97 Ga0395900_0723377 3300037418 Bacteria 927
98 Ga0395898_0003804 3300037466 Bacteria 16709
99 Ga0395898_0021758 3300037466 Bacteria 6498
100 Ga0395898_0033897 3300037466 Bacteria 5092
101 Ga0395901_0019814 3300038443 Bacteria 6880
102 Ga0451837_1021026 3300041494 Bacteria 685
103 Ga0466961_0066130 3300044693 Bacteria 2297
104 Ga0453684_0091201 3300044712 Bacteria 3762
105 Ga0495607_0022596 3300046501 Bacteria 3946
106 Ga0495606_0001701 3300046507 Bacteria 28416
107 Ga0495625_0025351 3300046660 Bacteria 4499
108 Ga0495686_0153396 3300047472 Bacteria 1351
109 Ga0496124_0038296 3300048927 Bacteria 4165
110 Ga0501034_0007761 3300049571 Bacteria 11410
111 Ga0501034_0043090 3300049571 Bacteria 4568
112 Ga0501034_0499457 3300049571 Bacteria 1130
113 Ga0501043_0120787 3300049579 Bacteria 2055
114 Ga0501047_0439550 3300049581 Bacteria 1135
115 Ga0501223_007878 3300049663 Unclassified 2174
116 Ga0501238_000056 3300049671 Bacteria 18343
117 Ga0500644_0017953 3300053088 Bacteria 2063
118 Ga0500562_000219 3300053108 Bacteria 15356
119 Ga0500568_0044556 3300053139 Bacteria 1769
120 Ga0500604_0005968 3300053151 Unclassified 3215
121 Ga0500616_0112816 3300053153 Bacteria 1310
122 Ga0500622_0000006 3300053156 Bacteria 464021
123 Ga0500622_0000038 3300053156 Bacteria 171777
124 Ga0500622_0000615 3300053156 Bacteria 32225
125 Ga0500645_040042 3300053730 Bacteria 1387
126 Ga0500645_041044 3300053730 Bacteria 1367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100268350 Ga0070680_1002683502 194
2 3300041494 Ga0451837_1021026 Ga0451837_1021026_27_614 195
3 iso_pu_bacteria 2738541273 2738700698 198
4 iso_pu_bacteria 2738543014 2739254447 198
5 iso_pu_bacteria 2738543023 2739303121 198
6 iso_pu_bacteria 2816332280 2817414644 198
7 iso_pu_bacteria 2818991444 2819591054 198
8 iso_pu_bacteria 2833640130 2833642848 198
9 iso_pu_bacteria 2857613821 2857615378 198
10 iso_pu_bacteria 2881247448 2881250831 198
11 iso_pu_bacteria 2890804823 2890806982 198
12 iso_pu_bacteria 2896317667 2896319774 198
13 iso_pu_bacteria 2898713307 2898716445 198
14 iso_pu_bacteria 2903895155 2903895724 198
15 iso_pu_bacteria 2904419702 2904422576 198
16 iso_pu_bacteria 2910245624 2910248408 198
17 iso_pu_bacteria 2914759650 2914759826 198
18 iso_pu_bacteria 2919506607 2919508915 198
19 iso_pu_bacteria 2929150217 2929151782 198
20 iso_pu_bacteria 2929154850 2929158647 198
21 iso_pu_bacteria 2958458903 2958462619 198
22 iso_pu_bacteria 8036736890 8036739717 198
23 iso_pu_bacteria 8055419101 8055419578 198
24 iso_pu_bacteria 2523533629 2524005390 199
25 iso_pu_bacteria 2643221665 2644362015 199
26 iso_pu_bacteria 2905999023 2905999917 199
27 iso_pu_bacteria 3003233435 3003236212 199
28 3300032126 Ga0307415_100210856 Ga0307415_1002108563 200
29 iso_pu_bacteria 2895498888 2895500913 200
30 iso_pu_bacteria 2896317667 2896320215 200
31 iso_pu_bacteria 2928515477 2928517538 200
32 iso_pu_bacteria 8055592153 8055595836 200
33 3300003323 rootH1_10044637 rootH1_100446372 201
34 3300005539 Ga0068853_100000453 Ga0068853_10000045315 201
35 3300005616 Ga0068852_100120062 Ga0068852_1001200622 201
36 3300009093 Ga0105240_10000908 Ga0105240_1000090839 201
37 3300009093 Ga0105240_10090718 Ga0105240_100907182 201
38 3300010375 Ga0105239_10001053 Ga0105239_1000105314 201
39 3300010375 Ga0105239_10016937 Ga0105239_100169376 201
40 3300025913 Ga0207695_10000462 Ga0207695_1000046236 201
41 3300025913 Ga0207695_10039860 Ga0207695_100398603 201
42 3300026041 Ga0207639_10022371 Ga0207639_100223712 201
43 3300026142 Ga0207698_10109366 Ga0207698_101093663 201
44 3300031251 Ga0265327_10005546 Ga0265327_100055462 201
45 3300032004 Ga0307414_10015617 Ga0307414_100156174 201
46 3300005288 Ga0065714_10125415 Ga0065714_101254151 202
47 3300005339 Ga0070660_100336510 Ga0070660_1003365102 202
48 3300005366 Ga0070659_100006541 Ga0070659_1000065418 202
49 3300005530 Ga0070679_100002117 Ga0070679_1000021178 202
50 3300005530 Ga0070679_100084396 Ga0070679_1000843963 202
51 3300005539 Ga0068853_100172167 Ga0068853_1001721671 202
52 3300005563 Ga0068855_100016101 Ga0068855_1000161012 202
53 3300005563 Ga0068855_100183217 Ga0068855_1001832172 202
54 3300005614 Ga0068856_100205019 Ga0068856_1002050191 202
55 3300006946 Ga0079104_1000028 Ga0079104_10000288 202
56 3300009011 Ga0105251_10190373 Ga0105251_101903732 202
57 3300009036 Ga0105244_10100790 Ga0105244_101007903 202
58 3300009545 Ga0105237_10012860 Ga0105237_100128605 202
59 3300009553 Ga0105249_10021840 Ga0105249_100218406 202
60 3300013100 Ga0157373_10013804 Ga0157373_100138046 202
61 3300013102 Ga0157371_10026920 Ga0157371_100269204 202
62 3300013104 Ga0157370_10362295 Ga0157370_103622952 202
63 3300013307 Ga0157372_10319367 Ga0157372_103193673 202
64 3300015261 Ga0182006_1035620 Ga0182006_10356203 202
65 3300015261 Ga0182006_1035621 Ga0182006_10356213 202
66 3300025735 Ga0207713_1075203 Ga0207713_10752032 202
67 3300025917 Ga0207660_10357439 Ga0207660_103574393 202
68 3300025919 Ga0207657_10038730 Ga0207657_100387305 202
69 3300025921 Ga0207652_10000621 Ga0207652_1000062124 202
70 3300025932 Ga0207690_10084849 Ga0207690_100848492 202
71 3300025949 Ga0207667_10020033 Ga0207667_100200332 202
72 3300025949 Ga0207667_11085342 Ga0207667_110853422 202
73 3300026041 Ga0207639_10409069 Ga0207639_104090691 202
74 3300026116 Ga0207674_10238568 Ga0207674_102385682 202
75 3300027111 Ga0209281_1000069 Ga0209281_100006974 202
76 3300027361 Ga0209489_113976 Ga0209489_1139763 202
77 3300027666 Ga0209282_1049152 Ga0209282_10491523 202
78 3300028794 Ga0307515_10000001 Ga0307515_100000011294 202
79 3300031903 Ga0307407_10032622 Ga0307407_100326223 202
80 3300031911 Ga0307412_10443907 Ga0307412_104439072 202
81 3300032002 Ga0307416_100000381 Ga0307416_1000003816 202
82 3300032004 Ga0307414_10000375 Ga0307414_1000037515 202
83 3300032004 Ga0307414_10038957 Ga0307414_100389575 202
84 3300032005 Ga0307411_10032415 Ga0307411_100324152 202
85 3300037312 Ga0395899_0003615 Ga0395899_0003615_7990_8598 202
86 3300046507 Ga0495606_0001701 Ga0495606_0001701_12674_13285 202
87 3300047472 Ga0495686_0153396 Ga0495686_0153396_428_1036 202
88 3300048927 Ga0496124_0038296 Ga0496124_0038296_3516_4124 202
89 3300049671 Ga0501238_000056 Ga0501238_000056_10232_10840 202
90 3300053088 Ga0500644_0017953 Ga0500644_0017953_923_1531 202
91 3300053108 Ga0500562_000219 Ga0500562_000219_5369_5977 202
92 3300053139 Ga0500568_0044556 Ga0500568_0044556_1080_1688 202
93 3300053151 Ga0500604_0005968 Ga0500604_0005968_2125_2733 202
94 3300053156 Ga0500622_0000006 Ga0500622_0000006_106368_106976 202
95 3300053156 Ga0500622_0000038 Ga0500622_0000038_125376_125984 202
96 3300053156 Ga0500622_0000615 Ga0500622_0000615_2950_3558 202
97 3300053730 Ga0500645_040042 Ga0500645_040042_317_925 202
98 3300053730 Ga0500645_041044 Ga0500645_041044_724_1332 202
99 3300005289 Ga0065704_10179569 Ga0065704_101795692 203
100 3300005353 Ga0070669_100760693 Ga0070669_1007606932 203
101 3300009011 Ga0105251_10001549 Ga0105251_1000154910 203
102 3300009036 Ga0105244_10028300 Ga0105244_100283003 203
103 3300009036 Ga0105244_10037973 Ga0105244_100379733 203
104 3300009092 Ga0105250_10005085 Ga0105250_100050859 203
105 3300009553 Ga0105249_10000425 Ga0105249_100004252 203
106 3300013102 Ga0157371_10025656 Ga0157371_100256564 203
107 3300013105 Ga0157369_10266734 Ga0157369_102667342 203
108 3300025711 Ga0207696_1039635 Ga0207696_10396353 203
109 3300025728 Ga0207655_1006651 Ga0207655_10066513 203
110 3300025728 Ga0207655_1023865 Ga0207655_10238654 203
111 3300025735 Ga0207713_1001800 Ga0207713_100180015 203
112 3300025961 Ga0207712_10010631 Ga0207712_100106312 203
113 3300028794 Ga0307515_10159731 Ga0307515_101597313 203
114 3300031548 Ga0307408_100000249 Ga0307408_10000024923 203
115 3300031901 Ga0307406_10001680 Ga0307406_100016808 203
116 3300046501 Ga0495607_0022596 Ga0495607_0022596_658_1269 203
117 3300046660 Ga0495625_0025351 Ga0495625_0025351_1080_1691 203
118 3300049571 Ga0501034_0499457 Ga0501034_0499457_455_1066 203
119 3300049663 Ga0501223_007878 Ga0501223_007878_1230_1841 203
120 iso_pu_bacteria 2881955468 2881956417 203
121 3300003320 rootH2_10051556 rootH2_100515562 204
122 3300005290 Ga0065712_10021797 Ga0065712_100217973 204
123 3300005339 Ga0070660_100049297 Ga0070660_1000492973 204
124 3300005455 Ga0070663_100284056 Ga0070663_1002840562 204
125 3300005458 Ga0070681_10471079 Ga0070681_104710792 204
126 3300005530 Ga0070679_100049150 Ga0070679_1000491503 204
127 3300005530 Ga0070679_100556753 Ga0070679_1005567532 204
128 3300005563 Ga0068855_100001027 Ga0068855_10000102726 204
129 3300009093 Ga0105240_10627256 Ga0105240_106272562 204
130 3300013102 Ga0157371_10003874 Ga0157371_1000387410 204
131 3300013104 Ga0157370_10001029 Ga0157370_1000102912 204
132 3300013307 Ga0157372_10012353 Ga0157372_100123531 204
133 3300013308 Ga0157375_10043461 Ga0157375_100434612 204
134 3300014326 Ga0157380_10268425 Ga0157380_102684251 204
135 3300017792 Ga0163161_10791868 Ga0163161_107918681 204
136 3300025919 Ga0207657_10109061 Ga0207657_101090612 204
137 3300025921 Ga0207652_10000482 Ga0207652_1000048241 204
138 3300025926 Ga0207659_10168651 Ga0207659_101686513 204
139 3300025929 Ga0207664_10335007 Ga0207664_103350073 204
140 3300025949 Ga0207667_10040005 Ga0207667_100400052 204
141 3300025972 Ga0207668_10156373 Ga0207668_101563733 204
142 3300026095 Ga0207676_11038231 Ga0207676_110382312 204
143 3300037312 Ga0395899_0079720 Ga0395899_0079720_1489_2106 204
144 3300037418 Ga0395900_0014908 Ga0395900_0014908_4014_4631 204
145 3300037418 Ga0395900_0723377 Ga0395900_0723377_127_753 204
146 3300037466 Ga0395898_0003804 Ga0395898_0003804_153_767 204
147 3300037466 Ga0395898_0021758 Ga0395898_0021758_4524_5150 204
148 3300037466 Ga0395898_0033897 Ga0395898_0033897_2278_2895 204
149 3300038443 Ga0395901_0019814 Ga0395901_0019814_6119_6736 204
150 3300044693 Ga0466961_0066130 Ga0466961_0066130_324_938 204
151 3300044712 Ga0453684_0091201 Ga0453684_0091201_1345_1968 204
152 3300049571 Ga0501034_0007761 Ga0501034_0007761_8337_8978 204
153 3300049571 Ga0501034_0043090 Ga0501034_0043090_2971_3612 204
154 3300049579 Ga0501043_0120787 Ga0501043_0120787_1107_1748 204
155 3300049581 Ga0501047_0439550 Ga0501047_0439550_352_1071 204
156 3300053153 Ga0500616_0112816 Ga0500616_0112816_255_887 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13532

2OG-FeII_Oxy_2

2OG-Fe(II) oxygenase superfamily

46

224

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rzl-assembly2.cif.gz_D duplex interrogation by a direct dna repair protein in the search of damage 0.9378 10 202
3rzg-assembly1.cif.gz_A duplex interrogation by a direct dna repair protein in the search of damage 0.9347 10 202
3s5a-assembly1.cif.gz_A abh2 cross-linked to undamaged dsdna-2 with cofactors 0.9329 10 202
3buc-assembly1.cif.gz_A x-ray structure of human abh2 bound to dsdna with mn(ii) and 2kg 0.9298 10 202
3btz-assembly1.cif.gz_A crystal structure of human abh2 cross-linked to dsdna 0.9232 12 202
ID Description Score Start End Superfamily
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9206 8 202 2.60.120.590
af_A4HSZ8_83_261_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9198 87 196 2.60.120.590
3rzlA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.916 8 202 2.60.120.590
af_Q9SIE0_90_314_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8959 8 201 2.60.120.590
2iuwA00 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.8525 7 200 2.60.120.590
ID Description Score Start End GO Terms
AF-A0A2T4DAR1-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9934 102 201 GO:0006307
GO:0008198
GO:0035516
GO:0051747
AF-A0A4U1CE80-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9908 28 201 GO:0006307
GO:0051213
AF-A0A4Q7AFW9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9899 12 203 GO:0006307
GO:0051213
AF-S7X5J3-F1-model_v4 DNA repair system specific for alkylated DNA 0.9887 86 201 GO:0006307
GO:0051213
AF-A0A5F1ZSC9-F1-model_v4 Alpha-ketoglutarate-dependent dioxygenase AlkB 0.9864 9 204 GO:0006307
GO:0051213

Feature Viewer

pLDDT pTM Quality
89.29 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map