F225809

General Info

Members Datasets Scaffolds Average Seq Length
156 122 153 300

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0010037|Ga0501034_0010037_6524_7555
Length 343
Sequence MTHMDTTNHASSHVILPLPGNDAFAQRLASEGGWPLGNLETRNFPDGESYLRILCDVTDKAVILVSTLSHPDEGFLRLVFAADAVRSLGAREVTLIAPYLAYMRQDRRFRPGEAVTSRTFARLVSATFDRLITVDPHLHRHPTLSAIYSIPTATLHAAPLLADWIGSEVKASLLIGPDEESEQWVSAIAKRIDAPHAVLRKVRHGDRDVEIELPDLSAWHDRQPVLVDDIASSGHTLIEAARKLRLQGLAPPDVAVVHGIFAGDSYQQLAPLCGRIVSTDSVVHASNRIELAPLIAAHLRTDTAAGSDQIRHRRPPEPLDAVERAGIDSFPASDPPPWLGGHR

Samples

Sample ID Description Type Environment
1 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
2 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
3 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
99 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
112 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
120 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.41
Nodule 0
Rhizoplane 0
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10012110 3300002239 Bacteria 1297
2 JGI24751J29686_10000437 3300002459 Bacteria 12906
3 JGI24751J29686_10003571 3300002459 Bacteria 3135
4 rootH1_10294202 3300003323 Unclassified 4651
5 Ga0065707_10226115 3300005295 Bacteria 1206
6 Ga0070670_100000339 3300005331 Bacteria 39253
7 Ga0070670_100002660 3300005331 Bacteria 14770
8 Ga0070666_10012350 3300005335 Bacteria 5384
9 Ga0070660_100002941 3300005339 Bacteria 11720
10 Ga0070668_100002607 3300005347 Bacteria 13254
11 Ga0070668_100108031 3300005347 Unclassified 2212
12 Ga0070669_100078825 3300005353 Bacteria 2449
13 Ga0070671_100000027 3300005355 Bacteria 114189
14 Ga0070673_100104849 3300005364 Unclassified 2335
15 Ga0070667_100000004 3300005367 Bacteria 444091
16 Ga0070667_100000623 3300005367 Bacteria 34501
17 Ga0070667_100016634 3300005367 Bacteria 6088
18 Ga0070713_100089713 3300005436 Unclassified 2641
19 Ga0070679_100039511 3300005530 Bacteria 4689
20 Ga0070665_100112676 3300005548 Bacteria 2723
21 Ga0068859_100039748 3300005617 Bacteria 4720
22 Ga0068864_100000133 3300005618 Bacteria 71914
23 Ga0068864_100000379 3300005618 Bacteria 38803
24 Ga0068861_100070353 3300005719 Bacteria 2709
25 Ga0068863_100000078 3300005841 Bacteria 108090
26 Ga0068863_100007183 3300005841 Bacteria 10931
27 Ga0068863_100221723 3300005841 Unclassified 1822
28 Ga0068858_100021339 3300005842 Bacteria 6050
29 Ga0068860_100000002 3300005843 Bacteria 627849
30 Ga0068860_100010624 3300005843 Bacteria 9091
31 Ga0068860_100236789 3300005843 Bacteria 1775
32 Ga0068862_100002573 3300005844 Bacteria 16022
33 Ga0081455_10004575 3300005937 Bacteria 15448
34 Ga0075367_10105765 3300006178 Bacteria 1724
35 Ga0075366_10026901 3300006195 Bacteria 3372
36 Ga0097621_100000226 3300006237 Bacteria 37795
37 Ga0075370_10000001 3300006353 Bacteria 239876
38 Ga0075370_10000900 3300006353 Bacteria 12177
39 Ga0075370_10032910 3300006353 Bacteria 2901
40 Ga0068871_100000241 3300006358 Bacteria 38434
41 Ga0068865_100006442 3300006881 Bacteria 7159
42 Ga0097620_100039748 3300006931 Bacteria 4720
43 Ga0105250_10024966 3300009092 Bacteria 2409
44 Ga0105240_10074661 3300009093 Bacteria 4184
45 Ga0114129_10503085 3300009147 Bacteria 1582
46 Ga0105241_10085699 3300009174 Bacteria 2476
47 Ga0105238_10050302 3300009551 Bacteria 4195
48 Ga0105249_10252332 3300009553 Bacteria 1749
49 Ga0105239_10036136 3300010375 Bacteria 5424
50 Ga0105246_10129989 3300011119 Unclassified 1879
51 Ga0157369_10000191 3300013105 Bacteria 84979
52 Ga0157374_10046365 3300013296 Bacteria 4025
53 Ga0157378_10102553 3300013297 Bacteria 2613
54 Ga0157372_10608740 3300013307 Bacteria 1273
55 Ga0157375_10000667 3300013308 Bacteria 30392
56 Ga0157375_10056850 3300013308 Bacteria 3865
57 Ga0157380_10003365 3300014326 Bacteria 10970
58 Ga0157379_10189192 3300014968 Bacteria 1860
59 Ga0157376_10002016 3300014969 Bacteria 13612
60 Ga0209758_1050362 3300025297 Bacteria 1461
61 Ga0207680_10057292 3300025903 Unclassified 2357
62 Ga0207680_10150910 3300025903 Unclassified 1549
63 Ga0207654_10118599 3300025911 Bacteria 1658
64 Ga0207695_10068546 3300025913 Bacteria 3635
65 Ga0207671_10017982 3300025914 Bacteria 5439
66 Ga0207663_10112614 3300025916 Bacteria 1849
67 Ga0207657_10017978 3300025919 Bacteria 6765
68 Ga0207652_10022827 3300025921 Bacteria 5182
69 Ga0207681_10006088 3300025923 Bacteria 7401
70 Ga0207694_10010294 3300025924 Bacteria 7049
71 Ga0207650_10000008 3300025925 Bacteria 498534
72 Ga0207650_10002924 3300025925 Bacteria 11785
73 Ga0207644_10000064 3300025931 Bacteria 77442
74 Ga0207686_10195163 3300025934 Unclassified 1446
75 Ga0207704_10004224 3300025938 Bacteria 6564
76 Ga0207651_10076661 3300025960 Unclassified 2391
77 Ga0207712_10024610 3300025961 Bacteria 3990
78 Ga0207668_10000024 3300025972 Bacteria 131871
79 Ga0207668_10175725 3300025972 Unclassified 1684
80 Ga0207658_10000002 3300025986 Bacteria 1364188
81 Ga0207658_10001804 3300025986 Bacteria 16035
82 Ga0207658_10002534 3300025986 Bacteria 13295
83 Ga0207703_10009769 3300026035 Bacteria 7529
84 Ga0207641_10000136 3300026088 Bacteria 108105
85 Ga0207641_10000475 3300026088 Bacteria 45483
86 Ga0207676_10000161 3300026095 Bacteria 58794
87 Ga0207676_10000264 3300026095 Bacteria 45636
88 Ga0207675_100090136 3300026118 Bacteria 2883
89 Ga0268266_10334954 3300028379 Bacteria 1419
90 Ga0268265_10000204 3300028380 Bacteria 68890
91 Ga0268264_10000001 3300028381 Bacteria 1221000
92 Ga0268264_10023749 3300028381 Bacteria 5000
93 Ga0265338_10024109 3300028800 Bacteria 6227
94 Ga0307509_10003607 3300031507 Bacteria 23273
95 Ga0307509_10155055 3300031507 Bacteria 2198
96 Ga0307508_10142049 3300031616 Bacteria 2005
97 Ga0307514_10025131 3300031649 Bacteria 4816
98 Ga0307516_10014631 3300031730 Bacteria 8291
99 Ga0307516_10285490 3300031730 Unclassified 1331
100 Ga0307516_10343172 3300031730 Bacteria 1160
101 Ga0307413_10034179 3300031824 Bacteria 2903
102 Ga0307410_10066831 3300031852 Bacteria 2478
103 Ga0307407_10162653 3300031903 Bacteria 1462
104 Ga0307411_10042496 3300032005 Bacteria 2900
105 Ga0307510_10036945 3300033180 Bacteria 5429
106 Ga0373936_0191479 3300035113 Bacteria 900
107 Ga0373954_0126591 3300035118 Bacteria 1242
108 Ga0373943_0018043 3300035170 Bacteria 3238
109 Ga0373927_0036227 3300035695 Bacteria 3209
110 Ga0373925_0062688 3300037068 Bacteria 2796
111 Ga0395898_0066424 3300037466 Bacteria 3494
112 Ga0395905_0000613 3300037471 Bacteria 47773
113 Ga0395905_0027643 3300037471 Bacteria 5349
114 Ga0395905_0057695 3300037471 Bacteria 3631
115 Ga0395905_0209296 3300037471 Bacteria 1827
116 Ga0395901_0405696 3300038443 Bacteria 1400
117 Ga0451577_0007747 3300042876 Bacteria 10526
118 Ga0466966_0120953 3300044684 Bacteria 1608
119 Ga0453684_0265348 3300044712 Bacteria 1965
120 Ga0466958_0271091 3300045836 Bacteria 1087
121 Ga0466967_0222138 3300045976 Bacteria 1796
122 Ga0495580_0022944 3300046472 Bacteria 4588
123 Ga0495664_0128251 3300046477 Bacteria 1535
124 Ga0495630_0051031 3300046517 Bacteria 3095
125 Ga0495642_0051703 3300046528 Bacteria 1691
126 Ga0495665_0054273 3300046531 Bacteria 2117
127 Ga0495586_0011832 3300046535 Bacteria 4637
128 Ga0495625_0048458 3300046660 Unclassified 3059
129 Ga0495613_0112601 3300046689 Bacteria 1960
130 Ga0495600_0299500 3300046809 Unclassified 1015
131 Ga0495674_0108028 3300047319 Bacteria 2361
132 Ga0495684_0114606 3300047471 Bacteria 2032
133 Ga0495593_0073257 3300047673 Bacteria 1777
134 Ga0496117_0016971 3300048920 Bacteria 6100
135 Ga0496118_0002776 3300048921 Bacteria 22930
136 Ga0496119_0017501 3300048922 Bacteria 5387
137 Ga0501034_0001831 3300049571 Bacteria 26995
138 Ga0501034_0010037 3300049571 Bacteria 9890
139 Ga0501036_0436262 3300049572 Bacteria 1092
140 Ga0501037_0096868 3300049573 Unclassified 2132
141 Ga0501043_0007933 3300049579 Bacteria 8389
142 Ga0501043_0060385 3300049579 Unclassified 2976
143 Ga0501047_0017151 3300049581 Bacteria 6929
144 Ga0501047_0222743 3300049581 Unclassified 1742
145 Ga0501035_0004589 3300049822 Bacteria 13099
146 Ga0501035_0021728 3300049822 Bacteria 5900
147 Ga0501044_0004586 3300049823 Bacteria 15453
148 Ga0501044_0121135 3300049823 Bacteria 2617
149 Ga0501044_0263921 3300049823 Bacteria 1660
150 nmdc:mga00v17_4210_c1 3300050491 Bacteria 6973
151 nmdc:mga0k408_25112_c1 3300050493 Bacteria 3372
152 nmdc:mga07m45_104012_c1 3300050496 Bacteria 1632
153 nmdc:mga07m45_2_c1 3300050496 Bacteria 451154

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035113 Ga0373936_0191479 Ga0373936_0191479_14_751 240
2 3300005843 Ga0068860_100236789 Ga0068860_1002367891 245
3 3300045836 Ga0466958_0271091 Ga0466958_0271091_12_767 246
4 iso_pu_bacteria 2884960567 2884964044 279
5 3300046809 Ga0495600_0299500 Ga0495600_0299500_144_998 280
6 3300046528 Ga0495642_0051703 Ga0495642_0051703_166_1053 283
7 3300006178 Ga0075367_10105765 Ga0075367_101057651 285
8 3300006353 Ga0075370_10000900 Ga0075370_100009002 285
9 3300049581 Ga0501047_0017151 Ga0501047_0017151_790_1662 285
10 3300049823 Ga0501044_0263921 Ga0501044_0263921_773_1645 285
11 3300009174 Ga0105241_10085699 Ga0105241_100856992 286
12 3300009551 Ga0105238_10050302 Ga0105238_100503023 286
13 3300010375 Ga0105239_10036136 Ga0105239_100361363 286
14 3300011119 Ga0105246_10129989 Ga0105246_101299892 286
15 3300013105 Ga0157369_10000191 Ga0157369_1000019120 286
16 3300025911 Ga0207654_10118599 Ga0207654_101185991 287
17 3300025913 Ga0207695_10068546 Ga0207695_100685463 287
18 3300025914 Ga0207671_10017982 Ga0207671_100179825 287
19 3300025916 Ga0207663_10112614 Ga0207663_101126142 287
20 3300025924 Ga0207694_10010294 Ga0207694_100102946 287
21 3300005339 Ga0070660_100002941 Ga0070660_1000029415 288
22 3300005530 Ga0070679_100039511 Ga0070679_1000395113 288
23 3300013297 Ga0157378_10102553 Ga0157378_101025534 288
24 3300025903 Ga0207680_10057292 Ga0207680_100572922 288
25 3300025919 Ga0207657_10017978 Ga0207657_100179788 288
26 3300025921 Ga0207652_10022827 Ga0207652_100228272 288
27 3300037471 Ga0395905_0000613 Ga0395905_0000613_3065_3949 288
28 3300049572 Ga0501036_0436262 Ga0501036_0436262_16_897 288
29 3300049823 Ga0501044_0121135 Ga0501044_0121135_829_1710 288
30 3300031824 Ga0307413_10034179 Ga0307413_100341792 289
31 3300042876 Ga0451577_0007747 Ga0451577_0007747_8816_9709 289
32 3300044712 Ga0453684_0265348 Ga0453684_0265348_818_1711 289
33 3300009093 Ga0105240_10074661 Ga0105240_100746613 290
34 3300025961 Ga0207712_10024610 Ga0207712_100246101 290
35 iso_pu_bacteria 2643221605 2644039720 290
36 3300005295 Ga0065707_10226115 Ga0065707_102261152 291
37 3300031507 Ga0307509_10003607 Ga0307509_1000360720 291
38 3300033180 Ga0307510_10036945 Ga0307510_100369455 291
39 3300037471 Ga0395905_0057695 Ga0395905_0057695_1394_2284 291
40 3300045976 Ga0466967_0222138 Ga0466967_0222138_88_978 291
41 3300049573 Ga0501037_0096868 Ga0501037_0096868_52_939 291
42 3300049579 Ga0501043_0060385 Ga0501043_0060385_2051_2938 291
43 3300049581 Ga0501047_0222743 Ga0501047_0222743_71_958 291
44 3300049822 Ga0501035_0021728 Ga0501035_0021728_2217_3104 291
45 3300049823 Ga0501044_0004586 Ga0501044_0004586_167_1054 291
46 3300005436 Ga0070713_100089713 Ga0070713_1000897132 292
47 3300006353 Ga0075370_10032910 Ga0075370_100329104 292
48 3300013307 Ga0157372_10608740 Ga0157372_106087402 292
49 3300025297 Ga0209758_1050362 Ga0209758_10503622 292
50 3300028800 Ga0265338_10024109 Ga0265338_100241095 292
51 3300031616 Ga0307508_10142049 Ga0307508_101420492 292
52 3300031852 Ga0307410_10066831 Ga0307410_100668312 292
53 3300035118 Ga0373954_0126591 Ga0373954_0126591_306_1202 292
54 3300035170 Ga0373943_0018043 Ga0373943_0018043_2027_2923 292
55 3300035695 Ga0373927_0036227 Ga0373927_0036227_104_1000 292
56 3300037068 Ga0373925_0062688 Ga0373925_0062688_1367_2263 292
57 3300037466 Ga0395898_0066424 Ga0395898_0066424_140_1033 292
58 3300038443 Ga0395901_0405696 Ga0395901_0405696_192_1085 292
59 3300044684 Ga0466966_0120953 Ga0466966_0120953_100_993 292
60 3300046472 Ga0495580_0022944 Ga0495580_0022944_1931_2827 292
61 3300046477 Ga0495664_0128251 Ga0495664_0128251_75_971 292
62 3300046517 Ga0495630_0051031 Ga0495630_0051031_234_1130 292
63 3300046531 Ga0495665_0054273 Ga0495665_0054273_759_1655 292
64 3300046535 Ga0495586_0011832 Ga0495586_0011832_1362_2258 292
65 3300046689 Ga0495613_0112601 Ga0495613_0112601_96_992 292
66 3300047319 Ga0495674_0108028 Ga0495674_0108028_121_1017 292
67 3300047471 Ga0495684_0114606 Ga0495684_0114606_358_1254 292
68 3300047673 Ga0495593_0073257 Ga0495593_0073257_510_1406 292
69 3300050496 nmdc:mga07m45_104012_c1 nmdc:mga07m45_104012_c1_479_1372 292
70 3300003323 rootH1_10294202 rootH1_102942022 293
71 3300006237 Ga0097621_100000226 Ga0097621_10000022616 293
72 3300006358 Ga0068871_100000241 Ga0068871_10000024129 293
73 3300037471 Ga0395905_0027643 Ga0395905_0027643_3945_4844 293
74 3300005618 Ga0068864_100000133 Ga0068864_10000013335 294
75 3300005841 Ga0068863_100000078 Ga0068863_10000007872 294
76 3300026088 Ga0207641_10000136 Ga0207641_1000013669 294
77 3300026095 Ga0207676_10000161 Ga0207676_1000016161 294
78 3300031903 Ga0307407_10162653 Ga0307407_101626532 294
79 3300032005 Ga0307411_10042496 Ga0307411_100424962 294
80 3300048922 Ga0496119_0017501 Ga0496119_0017501_3245_4153 294
81 3300031730 Ga0307516_10014631 Ga0307516_100146319 295
82 3300005367 Ga0070667_100000623 Ga0070667_1000006238 296
83 3300005548 Ga0070665_100112676 Ga0070665_1001126763 296
84 3300009092 Ga0105250_10024966 Ga0105250_100249662 296
85 3300013308 Ga0157375_10056850 Ga0157375_100568502 296
86 3300014968 Ga0157379_10189192 Ga0157379_101891923 296
87 3300025986 Ga0207658_10002534 Ga0207658_100025344 296
88 3300028379 Ga0268266_10334954 Ga0268266_103349542 296
89 3300031507 Ga0307509_10155055 Ga0307509_101550552 296
90 3300031730 Ga0307516_10285490 Ga0307516_102854901 296
91 3300046660 Ga0495625_0048458 Ga0495625_0048458_1625_2530 296
92 3300048920 Ga0496117_0016971 Ga0496117_0016971_1722_2636 296
93 3300048921 Ga0496118_0002776 Ga0496118_0002776_7011_7925 296
94 3300049571 Ga0501034_0001831 Ga0501034_0001831_7203_8177 296
95 3300006195 Ga0075366_10026901 Ga0075366_100269012 297
96 3300006353 Ga0075370_10000001 Ga0075370_10000001141 297
97 3300009147 Ga0114129_10503085 Ga0114129_105030853 297
98 3300031730 Ga0307516_10343172 Ga0307516_103431721 297
99 3300050491 nmdc:mga00v17_4210_c1 nmdc:mga00v17_4210_c1_5195_6115 297
100 3300050493 nmdc:mga0k408_25112_c1 nmdc:mga0k408_25112_c1_784_1692 297
101 3300050496 nmdc:mga07m45_2_c1 nmdc:mga07m45_2_c1_117486_118394 297
102 3300037471 Ga0395905_0209296 Ga0395905_0209296_448_1398 298
103 3300005843 Ga0068860_100010624 Ga0068860_1000106242 299
104 3300028381 Ga0268264_10023749 Ga0268264_100237493 299
105 3300031649 Ga0307514_10025131 Ga0307514_100251313 299
106 iso_pu_bacteria 2643221579 2643906127 299
107 3300005331 Ga0070670_100000339 Ga0070670_10000033929 300
108 3300005367 Ga0070667_100016634 Ga0070667_1000166342 300
109 3300005937 Ga0081455_10004575 Ga0081455_1000457523 300
110 3300014969 Ga0157376_10002016 Ga0157376_100020164 300
111 3300002459 JGI24751J29686_10000437 JGI24751J29686_1000043715 301
112 3300005335 Ga0070666_10012350 Ga0070666_100123502 301
113 3300005347 Ga0070668_100108031 Ga0070668_1001080312 301
114 3300005364 Ga0070673_100104849 Ga0070673_1001048492 301
115 3300005618 Ga0068864_100000379 Ga0068864_10000037915 301
116 3300005719 Ga0068861_100070353 Ga0068861_1000703531 301
117 3300005841 Ga0068863_100221723 Ga0068863_1002217232 301
118 3300006881 Ga0068865_100006442 Ga0068865_1000064424 301
119 3300009553 Ga0105249_10252332 Ga0105249_102523321 301
120 3300013296 Ga0157374_10046365 Ga0157374_100463652 301
121 3300013308 Ga0157375_10000667 Ga0157375_1000066712 301
122 3300014326 Ga0157380_10003365 Ga0157380_100033653 301
123 3300025903 Ga0207680_10150910 Ga0207680_101509102 301
124 3300025925 Ga0207650_10000008 Ga0207650_10000008431 301
125 3300025934 Ga0207686_10195163 Ga0207686_101951632 301
126 3300025938 Ga0207704_10004224 Ga0207704_100042244 301
127 3300025960 Ga0207651_10076661 Ga0207651_100766612 301
128 3300025972 Ga0207668_10175725 Ga0207668_101757251 301
129 3300025986 Ga0207658_10001804 Ga0207658_100018046 301
130 3300026095 Ga0207676_10000264 Ga0207676_1000026433 301
131 3300026118 Ga0207675_100090136 Ga0207675_1000901364 301
132 3300049822 Ga0501035_0004589 Ga0501035_0004589_5632_6651 301
133 3300002239 JGI24034J26672_10012110 JGI24034J26672_100121101 302
134 3300002459 JGI24751J29686_10003571 JGI24751J29686_100035712 302
135 3300005331 Ga0070670_100002660 Ga0070670_10000266010 302
136 3300005347 Ga0070668_100002607 Ga0070668_1000026074 302
137 3300005353 Ga0070669_100078825 Ga0070669_1000788251 302
138 3300005355 Ga0070671_100000027 Ga0070671_100000027117 302
139 3300005367 Ga0070667_100000004 Ga0070667_10000000442 302
140 3300005617 Ga0068859_100039748 Ga0068859_1000397485 302
141 3300005841 Ga0068863_100007183 Ga0068863_1000071834 302
142 3300005842 Ga0068858_100021339 Ga0068858_1000213396 302
143 3300005843 Ga0068860_100000002 Ga0068860_10000000227 302
144 3300005844 Ga0068862_100002573 Ga0068862_1000025738 302
145 3300006931 Ga0097620_100039748 Ga0097620_1000397485 302
146 3300025923 Ga0207681_10006088 Ga0207681_100060882 302
147 3300025925 Ga0207650_10002924 Ga0207650_100029247 302
148 3300025931 Ga0207644_10000064 Ga0207644_1000006433 302
149 3300025972 Ga0207668_10000024 Ga0207668_10000024112 302
150 3300025986 Ga0207658_10000002 Ga0207658_10000002334 302
151 3300026035 Ga0207703_10009769 Ga0207703_100097692 302
152 3300026088 Ga0207641_10000475 Ga0207641_1000047541 302
153 3300028380 Ga0268265_10000204 Ga0268265_1000020436 302
154 3300028381 Ga0268264_10000001 Ga0268264_10000001659 302
155 3300049571 Ga0501034_0010037 Ga0501034_0010037_6524_7555 302
156 3300049579 Ga0501043_0007933 Ga0501043_0007933_2613_3644 302

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13793

Pribosyltran_N

N-terminal domain of ribose phosphate pyrophosphokinase

13

127

0.95

PF00156

Pribosyltran

Phosphoribosyl transferase domain

143

268

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u9y-assembly1.cif.gz_A crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii 0.8957 4 283
8dbo-assembly1.cif.gz_A human prps1-e307a engineered mutation with adp; hexamer 0.8905 3 285
8dbe-assembly1.cif.gz_A human prps1 with adp; hexamer 0.89 3 285
4twb-assembly3.cif.gz_E sulfolobus solfataricus ribose-phosphate pyrophosphokinase 0.8885 4 276
1u9y-assembly1.cif.gz_A crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii 0.8832 4 283
ID Description Score Start End Superfamily
3mbiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.904 1 145 3.40.50.2020
af_P9WKE3_10_163_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8985 1 155 3.40.50.2020
af_P87171_7_220_3.40.50.10090 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8976 6 193 3.40.50.10090
af_Q2G0S2_14_197_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8972 6 185 3.40.50.2020
1u9yA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8962 4 145 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A2X1ALS2-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9748 2 292 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A7X7PSU1-F1-model_v4 Ribose-phosphate pyrophosphokinase 0.9684 1 285 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A3D2L8D8-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9667 2 168 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-A0A2Z6E5K9-F1-model_v4 Ribose-phosphate pyrophosphokinase 0.9649 1 285 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301
AF-X1CG91-F1-model_v4 ribose-phosphate diphosphokinase (EC 2.7.6.1) 0.9624 1 152 GO:0000287
GO:0002189
GO:0004749
GO:0005737
GO:0006015
GO:0006164
GO:0016301

Feature Viewer

pLDDT pTM Quality
91.63 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map