F225809
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 156 | 122 | 153 | 300 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0010037|Ga0501034_0010037_6524_7555 |
| Length | 343 |
| Sequence | MTHMDTTNHASSHVILPLPGNDAFAQRLASEGGWPLGNLETRNFPDGESYLRILCDVTDKAVILVSTLSHPDEGFLRLVFAADAVRSLGAREVTLIAPYLAYMRQDRRFRPGEAVTSRTFARLVSATFDRLITVDPHLHRHPTLSAIYSIPTATLHAAPLLADWIGSEVKASLLIGPDEESEQWVSAIAKRIDAPHAVLRKVRHGDRDVEIELPDLSAWHDRQPVLVDDIASSGHTLIEAARKLRLQGLAPPDVAVVHGIFAGDSYQQLAPLCGRIVSTDSVVHASNRIELAPLIAAHLRTDTAAGSDQIRHRRPPEPLDAVERAGIDSFPASDPPPWLGGHR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 2 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 3 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 20 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 21 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 22 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 23 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 24 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 25 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 28 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 29 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 31 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 32 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 33 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 51 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 76 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 77 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 78 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 79 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 80 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 81 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 82 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 83 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 84 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 85 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 86 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 87 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 88 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 89 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 90 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 91 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 92 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 93 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 94 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 95 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 96 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 97 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 98 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 111 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 112 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 113 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 121 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 122 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 0 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.41 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 84.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24034J26672_10012110 | 3300002239 | Bacteria | 1297 |
| 2 | JGI24751J29686_10000437 | 3300002459 | Bacteria | 12906 |
| 3 | JGI24751J29686_10003571 | 3300002459 | Bacteria | 3135 |
| 4 | rootH1_10294202 | 3300003323 | Unclassified | 4651 |
| 5 | Ga0065707_10226115 | 3300005295 | Bacteria | 1206 |
| 6 | Ga0070670_100000339 | 3300005331 | Bacteria | 39253 |
| 7 | Ga0070670_100002660 | 3300005331 | Bacteria | 14770 |
| 8 | Ga0070666_10012350 | 3300005335 | Bacteria | 5384 |
| 9 | Ga0070660_100002941 | 3300005339 | Bacteria | 11720 |
| 10 | Ga0070668_100002607 | 3300005347 | Bacteria | 13254 |
| 11 | Ga0070668_100108031 | 3300005347 | Unclassified | 2212 |
| 12 | Ga0070669_100078825 | 3300005353 | Bacteria | 2449 |
| 13 | Ga0070671_100000027 | 3300005355 | Bacteria | 114189 |
| 14 | Ga0070673_100104849 | 3300005364 | Unclassified | 2335 |
| 15 | Ga0070667_100000004 | 3300005367 | Bacteria | 444091 |
| 16 | Ga0070667_100000623 | 3300005367 | Bacteria | 34501 |
| 17 | Ga0070667_100016634 | 3300005367 | Bacteria | 6088 |
| 18 | Ga0070713_100089713 | 3300005436 | Unclassified | 2641 |
| 19 | Ga0070679_100039511 | 3300005530 | Bacteria | 4689 |
| 20 | Ga0070665_100112676 | 3300005548 | Bacteria | 2723 |
| 21 | Ga0068859_100039748 | 3300005617 | Bacteria | 4720 |
| 22 | Ga0068864_100000133 | 3300005618 | Bacteria | 71914 |
| 23 | Ga0068864_100000379 | 3300005618 | Bacteria | 38803 |
| 24 | Ga0068861_100070353 | 3300005719 | Bacteria | 2709 |
| 25 | Ga0068863_100000078 | 3300005841 | Bacteria | 108090 |
| 26 | Ga0068863_100007183 | 3300005841 | Bacteria | 10931 |
| 27 | Ga0068863_100221723 | 3300005841 | Unclassified | 1822 |
| 28 | Ga0068858_100021339 | 3300005842 | Bacteria | 6050 |
| 29 | Ga0068860_100000002 | 3300005843 | Bacteria | 627849 |
| 30 | Ga0068860_100010624 | 3300005843 | Bacteria | 9091 |
| 31 | Ga0068860_100236789 | 3300005843 | Bacteria | 1775 |
| 32 | Ga0068862_100002573 | 3300005844 | Bacteria | 16022 |
| 33 | Ga0081455_10004575 | 3300005937 | Bacteria | 15448 |
| 34 | Ga0075367_10105765 | 3300006178 | Bacteria | 1724 |
| 35 | Ga0075366_10026901 | 3300006195 | Bacteria | 3372 |
| 36 | Ga0097621_100000226 | 3300006237 | Bacteria | 37795 |
| 37 | Ga0075370_10000001 | 3300006353 | Bacteria | 239876 |
| 38 | Ga0075370_10000900 | 3300006353 | Bacteria | 12177 |
| 39 | Ga0075370_10032910 | 3300006353 | Bacteria | 2901 |
| 40 | Ga0068871_100000241 | 3300006358 | Bacteria | 38434 |
| 41 | Ga0068865_100006442 | 3300006881 | Bacteria | 7159 |
| 42 | Ga0097620_100039748 | 3300006931 | Bacteria | 4720 |
| 43 | Ga0105250_10024966 | 3300009092 | Bacteria | 2409 |
| 44 | Ga0105240_10074661 | 3300009093 | Bacteria | 4184 |
| 45 | Ga0114129_10503085 | 3300009147 | Bacteria | 1582 |
| 46 | Ga0105241_10085699 | 3300009174 | Bacteria | 2476 |
| 47 | Ga0105238_10050302 | 3300009551 | Bacteria | 4195 |
| 48 | Ga0105249_10252332 | 3300009553 | Bacteria | 1749 |
| 49 | Ga0105239_10036136 | 3300010375 | Bacteria | 5424 |
| 50 | Ga0105246_10129989 | 3300011119 | Unclassified | 1879 |
| 51 | Ga0157369_10000191 | 3300013105 | Bacteria | 84979 |
| 52 | Ga0157374_10046365 | 3300013296 | Bacteria | 4025 |
| 53 | Ga0157378_10102553 | 3300013297 | Bacteria | 2613 |
| 54 | Ga0157372_10608740 | 3300013307 | Bacteria | 1273 |
| 55 | Ga0157375_10000667 | 3300013308 | Bacteria | 30392 |
| 56 | Ga0157375_10056850 | 3300013308 | Bacteria | 3865 |
| 57 | Ga0157380_10003365 | 3300014326 | Bacteria | 10970 |
| 58 | Ga0157379_10189192 | 3300014968 | Bacteria | 1860 |
| 59 | Ga0157376_10002016 | 3300014969 | Bacteria | 13612 |
| 60 | Ga0209758_1050362 | 3300025297 | Bacteria | 1461 |
| 61 | Ga0207680_10057292 | 3300025903 | Unclassified | 2357 |
| 62 | Ga0207680_10150910 | 3300025903 | Unclassified | 1549 |
| 63 | Ga0207654_10118599 | 3300025911 | Bacteria | 1658 |
| 64 | Ga0207695_10068546 | 3300025913 | Bacteria | 3635 |
| 65 | Ga0207671_10017982 | 3300025914 | Bacteria | 5439 |
| 66 | Ga0207663_10112614 | 3300025916 | Bacteria | 1849 |
| 67 | Ga0207657_10017978 | 3300025919 | Bacteria | 6765 |
| 68 | Ga0207652_10022827 | 3300025921 | Bacteria | 5182 |
| 69 | Ga0207681_10006088 | 3300025923 | Bacteria | 7401 |
| 70 | Ga0207694_10010294 | 3300025924 | Bacteria | 7049 |
| 71 | Ga0207650_10000008 | 3300025925 | Bacteria | 498534 |
| 72 | Ga0207650_10002924 | 3300025925 | Bacteria | 11785 |
| 73 | Ga0207644_10000064 | 3300025931 | Bacteria | 77442 |
| 74 | Ga0207686_10195163 | 3300025934 | Unclassified | 1446 |
| 75 | Ga0207704_10004224 | 3300025938 | Bacteria | 6564 |
| 76 | Ga0207651_10076661 | 3300025960 | Unclassified | 2391 |
| 77 | Ga0207712_10024610 | 3300025961 | Bacteria | 3990 |
| 78 | Ga0207668_10000024 | 3300025972 | Bacteria | 131871 |
| 79 | Ga0207668_10175725 | 3300025972 | Unclassified | 1684 |
| 80 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 81 | Ga0207658_10001804 | 3300025986 | Bacteria | 16035 |
| 82 | Ga0207658_10002534 | 3300025986 | Bacteria | 13295 |
| 83 | Ga0207703_10009769 | 3300026035 | Bacteria | 7529 |
| 84 | Ga0207641_10000136 | 3300026088 | Bacteria | 108105 |
| 85 | Ga0207641_10000475 | 3300026088 | Bacteria | 45483 |
| 86 | Ga0207676_10000161 | 3300026095 | Bacteria | 58794 |
| 87 | Ga0207676_10000264 | 3300026095 | Bacteria | 45636 |
| 88 | Ga0207675_100090136 | 3300026118 | Bacteria | 2883 |
| 89 | Ga0268266_10334954 | 3300028379 | Bacteria | 1419 |
| 90 | Ga0268265_10000204 | 3300028380 | Bacteria | 68890 |
| 91 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 92 | Ga0268264_10023749 | 3300028381 | Bacteria | 5000 |
| 93 | Ga0265338_10024109 | 3300028800 | Bacteria | 6227 |
| 94 | Ga0307509_10003607 | 3300031507 | Bacteria | 23273 |
| 95 | Ga0307509_10155055 | 3300031507 | Bacteria | 2198 |
| 96 | Ga0307508_10142049 | 3300031616 | Bacteria | 2005 |
| 97 | Ga0307514_10025131 | 3300031649 | Bacteria | 4816 |
| 98 | Ga0307516_10014631 | 3300031730 | Bacteria | 8291 |
| 99 | Ga0307516_10285490 | 3300031730 | Unclassified | 1331 |
| 100 | Ga0307516_10343172 | 3300031730 | Bacteria | 1160 |
| 101 | Ga0307413_10034179 | 3300031824 | Bacteria | 2903 |
| 102 | Ga0307410_10066831 | 3300031852 | Bacteria | 2478 |
| 103 | Ga0307407_10162653 | 3300031903 | Bacteria | 1462 |
| 104 | Ga0307411_10042496 | 3300032005 | Bacteria | 2900 |
| 105 | Ga0307510_10036945 | 3300033180 | Bacteria | 5429 |
| 106 | Ga0373936_0191479 | 3300035113 | Bacteria | 900 |
| 107 | Ga0373954_0126591 | 3300035118 | Bacteria | 1242 |
| 108 | Ga0373943_0018043 | 3300035170 | Bacteria | 3238 |
| 109 | Ga0373927_0036227 | 3300035695 | Bacteria | 3209 |
| 110 | Ga0373925_0062688 | 3300037068 | Bacteria | 2796 |
| 111 | Ga0395898_0066424 | 3300037466 | Bacteria | 3494 |
| 112 | Ga0395905_0000613 | 3300037471 | Bacteria | 47773 |
| 113 | Ga0395905_0027643 | 3300037471 | Bacteria | 5349 |
| 114 | Ga0395905_0057695 | 3300037471 | Bacteria | 3631 |
| 115 | Ga0395905_0209296 | 3300037471 | Bacteria | 1827 |
| 116 | Ga0395901_0405696 | 3300038443 | Bacteria | 1400 |
| 117 | Ga0451577_0007747 | 3300042876 | Bacteria | 10526 |
| 118 | Ga0466966_0120953 | 3300044684 | Bacteria | 1608 |
| 119 | Ga0453684_0265348 | 3300044712 | Bacteria | 1965 |
| 120 | Ga0466958_0271091 | 3300045836 | Bacteria | 1087 |
| 121 | Ga0466967_0222138 | 3300045976 | Bacteria | 1796 |
| 122 | Ga0495580_0022944 | 3300046472 | Bacteria | 4588 |
| 123 | Ga0495664_0128251 | 3300046477 | Bacteria | 1535 |
| 124 | Ga0495630_0051031 | 3300046517 | Bacteria | 3095 |
| 125 | Ga0495642_0051703 | 3300046528 | Bacteria | 1691 |
| 126 | Ga0495665_0054273 | 3300046531 | Bacteria | 2117 |
| 127 | Ga0495586_0011832 | 3300046535 | Bacteria | 4637 |
| 128 | Ga0495625_0048458 | 3300046660 | Unclassified | 3059 |
| 129 | Ga0495613_0112601 | 3300046689 | Bacteria | 1960 |
| 130 | Ga0495600_0299500 | 3300046809 | Unclassified | 1015 |
| 131 | Ga0495674_0108028 | 3300047319 | Bacteria | 2361 |
| 132 | Ga0495684_0114606 | 3300047471 | Bacteria | 2032 |
| 133 | Ga0495593_0073257 | 3300047673 | Bacteria | 1777 |
| 134 | Ga0496117_0016971 | 3300048920 | Bacteria | 6100 |
| 135 | Ga0496118_0002776 | 3300048921 | Bacteria | 22930 |
| 136 | Ga0496119_0017501 | 3300048922 | Bacteria | 5387 |
| 137 | Ga0501034_0001831 | 3300049571 | Bacteria | 26995 |
| 138 | Ga0501034_0010037 | 3300049571 | Bacteria | 9890 |
| 139 | Ga0501036_0436262 | 3300049572 | Bacteria | 1092 |
| 140 | Ga0501037_0096868 | 3300049573 | Unclassified | 2132 |
| 141 | Ga0501043_0007933 | 3300049579 | Bacteria | 8389 |
| 142 | Ga0501043_0060385 | 3300049579 | Unclassified | 2976 |
| 143 | Ga0501047_0017151 | 3300049581 | Bacteria | 6929 |
| 144 | Ga0501047_0222743 | 3300049581 | Unclassified | 1742 |
| 145 | Ga0501035_0004589 | 3300049822 | Bacteria | 13099 |
| 146 | Ga0501035_0021728 | 3300049822 | Bacteria | 5900 |
| 147 | Ga0501044_0004586 | 3300049823 | Bacteria | 15453 |
| 148 | Ga0501044_0121135 | 3300049823 | Bacteria | 2617 |
| 149 | Ga0501044_0263921 | 3300049823 | Bacteria | 1660 |
| 150 | nmdc:mga00v17_4210_c1 | 3300050491 | Bacteria | 6973 |
| 151 | nmdc:mga0k408_25112_c1 | 3300050493 | Bacteria | 3372 |
| 152 | nmdc:mga07m45_104012_c1 | 3300050496 | Bacteria | 1632 |
| 153 | nmdc:mga07m45_2_c1 | 3300050496 | Bacteria | 451154 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035113 | Ga0373936_0191479 | Ga0373936_0191479_14_751 | 240 |
| 2 | 3300005843 | Ga0068860_100236789 | Ga0068860_1002367891 | 245 |
| 3 | 3300045836 | Ga0466958_0271091 | Ga0466958_0271091_12_767 | 246 |
| 4 | iso_pu_bacteria | 2884960567 | 2884964044 | 279 |
| 5 | 3300046809 | Ga0495600_0299500 | Ga0495600_0299500_144_998 | 280 |
| 6 | 3300046528 | Ga0495642_0051703 | Ga0495642_0051703_166_1053 | 283 |
| 7 | 3300006178 | Ga0075367_10105765 | Ga0075367_101057651 | 285 |
| 8 | 3300006353 | Ga0075370_10000900 | Ga0075370_100009002 | 285 |
| 9 | 3300049581 | Ga0501047_0017151 | Ga0501047_0017151_790_1662 | 285 |
| 10 | 3300049823 | Ga0501044_0263921 | Ga0501044_0263921_773_1645 | 285 |
| 11 | 3300009174 | Ga0105241_10085699 | Ga0105241_100856992 | 286 |
| 12 | 3300009551 | Ga0105238_10050302 | Ga0105238_100503023 | 286 |
| 13 | 3300010375 | Ga0105239_10036136 | Ga0105239_100361363 | 286 |
| 14 | 3300011119 | Ga0105246_10129989 | Ga0105246_101299892 | 286 |
| 15 | 3300013105 | Ga0157369_10000191 | Ga0157369_1000019120 | 286 |
| 16 | 3300025911 | Ga0207654_10118599 | Ga0207654_101185991 | 287 |
| 17 | 3300025913 | Ga0207695_10068546 | Ga0207695_100685463 | 287 |
| 18 | 3300025914 | Ga0207671_10017982 | Ga0207671_100179825 | 287 |
| 19 | 3300025916 | Ga0207663_10112614 | Ga0207663_101126142 | 287 |
| 20 | 3300025924 | Ga0207694_10010294 | Ga0207694_100102946 | 287 |
| 21 | 3300005339 | Ga0070660_100002941 | Ga0070660_1000029415 | 288 |
| 22 | 3300005530 | Ga0070679_100039511 | Ga0070679_1000395113 | 288 |
| 23 | 3300013297 | Ga0157378_10102553 | Ga0157378_101025534 | 288 |
| 24 | 3300025903 | Ga0207680_10057292 | Ga0207680_100572922 | 288 |
| 25 | 3300025919 | Ga0207657_10017978 | Ga0207657_100179788 | 288 |
| 26 | 3300025921 | Ga0207652_10022827 | Ga0207652_100228272 | 288 |
| 27 | 3300037471 | Ga0395905_0000613 | Ga0395905_0000613_3065_3949 | 288 |
| 28 | 3300049572 | Ga0501036_0436262 | Ga0501036_0436262_16_897 | 288 |
| 29 | 3300049823 | Ga0501044_0121135 | Ga0501044_0121135_829_1710 | 288 |
| 30 | 3300031824 | Ga0307413_10034179 | Ga0307413_100341792 | 289 |
| 31 | 3300042876 | Ga0451577_0007747 | Ga0451577_0007747_8816_9709 | 289 |
| 32 | 3300044712 | Ga0453684_0265348 | Ga0453684_0265348_818_1711 | 289 |
| 33 | 3300009093 | Ga0105240_10074661 | Ga0105240_100746613 | 290 |
| 34 | 3300025961 | Ga0207712_10024610 | Ga0207712_100246101 | 290 |
| 35 | iso_pu_bacteria | 2643221605 | 2644039720 | 290 |
| 36 | 3300005295 | Ga0065707_10226115 | Ga0065707_102261152 | 291 |
| 37 | 3300031507 | Ga0307509_10003607 | Ga0307509_1000360720 | 291 |
| 38 | 3300033180 | Ga0307510_10036945 | Ga0307510_100369455 | 291 |
| 39 | 3300037471 | Ga0395905_0057695 | Ga0395905_0057695_1394_2284 | 291 |
| 40 | 3300045976 | Ga0466967_0222138 | Ga0466967_0222138_88_978 | 291 |
| 41 | 3300049573 | Ga0501037_0096868 | Ga0501037_0096868_52_939 | 291 |
| 42 | 3300049579 | Ga0501043_0060385 | Ga0501043_0060385_2051_2938 | 291 |
| 43 | 3300049581 | Ga0501047_0222743 | Ga0501047_0222743_71_958 | 291 |
| 44 | 3300049822 | Ga0501035_0021728 | Ga0501035_0021728_2217_3104 | 291 |
| 45 | 3300049823 | Ga0501044_0004586 | Ga0501044_0004586_167_1054 | 291 |
| 46 | 3300005436 | Ga0070713_100089713 | Ga0070713_1000897132 | 292 |
| 47 | 3300006353 | Ga0075370_10032910 | Ga0075370_100329104 | 292 |
| 48 | 3300013307 | Ga0157372_10608740 | Ga0157372_106087402 | 292 |
| 49 | 3300025297 | Ga0209758_1050362 | Ga0209758_10503622 | 292 |
| 50 | 3300028800 | Ga0265338_10024109 | Ga0265338_100241095 | 292 |
| 51 | 3300031616 | Ga0307508_10142049 | Ga0307508_101420492 | 292 |
| 52 | 3300031852 | Ga0307410_10066831 | Ga0307410_100668312 | 292 |
| 53 | 3300035118 | Ga0373954_0126591 | Ga0373954_0126591_306_1202 | 292 |
| 54 | 3300035170 | Ga0373943_0018043 | Ga0373943_0018043_2027_2923 | 292 |
| 55 | 3300035695 | Ga0373927_0036227 | Ga0373927_0036227_104_1000 | 292 |
| 56 | 3300037068 | Ga0373925_0062688 | Ga0373925_0062688_1367_2263 | 292 |
| 57 | 3300037466 | Ga0395898_0066424 | Ga0395898_0066424_140_1033 | 292 |
| 58 | 3300038443 | Ga0395901_0405696 | Ga0395901_0405696_192_1085 | 292 |
| 59 | 3300044684 | Ga0466966_0120953 | Ga0466966_0120953_100_993 | 292 |
| 60 | 3300046472 | Ga0495580_0022944 | Ga0495580_0022944_1931_2827 | 292 |
| 61 | 3300046477 | Ga0495664_0128251 | Ga0495664_0128251_75_971 | 292 |
| 62 | 3300046517 | Ga0495630_0051031 | Ga0495630_0051031_234_1130 | 292 |
| 63 | 3300046531 | Ga0495665_0054273 | Ga0495665_0054273_759_1655 | 292 |
| 64 | 3300046535 | Ga0495586_0011832 | Ga0495586_0011832_1362_2258 | 292 |
| 65 | 3300046689 | Ga0495613_0112601 | Ga0495613_0112601_96_992 | 292 |
| 66 | 3300047319 | Ga0495674_0108028 | Ga0495674_0108028_121_1017 | 292 |
| 67 | 3300047471 | Ga0495684_0114606 | Ga0495684_0114606_358_1254 | 292 |
| 68 | 3300047673 | Ga0495593_0073257 | Ga0495593_0073257_510_1406 | 292 |
| 69 | 3300050496 | nmdc:mga07m45_104012_c1 | nmdc:mga07m45_104012_c1_479_1372 | 292 |
| 70 | 3300003323 | rootH1_10294202 | rootH1_102942022 | 293 |
| 71 | 3300006237 | Ga0097621_100000226 | Ga0097621_10000022616 | 293 |
| 72 | 3300006358 | Ga0068871_100000241 | Ga0068871_10000024129 | 293 |
| 73 | 3300037471 | Ga0395905_0027643 | Ga0395905_0027643_3945_4844 | 293 |
| 74 | 3300005618 | Ga0068864_100000133 | Ga0068864_10000013335 | 294 |
| 75 | 3300005841 | Ga0068863_100000078 | Ga0068863_10000007872 | 294 |
| 76 | 3300026088 | Ga0207641_10000136 | Ga0207641_1000013669 | 294 |
| 77 | 3300026095 | Ga0207676_10000161 | Ga0207676_1000016161 | 294 |
| 78 | 3300031903 | Ga0307407_10162653 | Ga0307407_101626532 | 294 |
| 79 | 3300032005 | Ga0307411_10042496 | Ga0307411_100424962 | 294 |
| 80 | 3300048922 | Ga0496119_0017501 | Ga0496119_0017501_3245_4153 | 294 |
| 81 | 3300031730 | Ga0307516_10014631 | Ga0307516_100146319 | 295 |
| 82 | 3300005367 | Ga0070667_100000623 | Ga0070667_1000006238 | 296 |
| 83 | 3300005548 | Ga0070665_100112676 | Ga0070665_1001126763 | 296 |
| 84 | 3300009092 | Ga0105250_10024966 | Ga0105250_100249662 | 296 |
| 85 | 3300013308 | Ga0157375_10056850 | Ga0157375_100568502 | 296 |
| 86 | 3300014968 | Ga0157379_10189192 | Ga0157379_101891923 | 296 |
| 87 | 3300025986 | Ga0207658_10002534 | Ga0207658_100025344 | 296 |
| 88 | 3300028379 | Ga0268266_10334954 | Ga0268266_103349542 | 296 |
| 89 | 3300031507 | Ga0307509_10155055 | Ga0307509_101550552 | 296 |
| 90 | 3300031730 | Ga0307516_10285490 | Ga0307516_102854901 | 296 |
| 91 | 3300046660 | Ga0495625_0048458 | Ga0495625_0048458_1625_2530 | 296 |
| 92 | 3300048920 | Ga0496117_0016971 | Ga0496117_0016971_1722_2636 | 296 |
| 93 | 3300048921 | Ga0496118_0002776 | Ga0496118_0002776_7011_7925 | 296 |
| 94 | 3300049571 | Ga0501034_0001831 | Ga0501034_0001831_7203_8177 | 296 |
| 95 | 3300006195 | Ga0075366_10026901 | Ga0075366_100269012 | 297 |
| 96 | 3300006353 | Ga0075370_10000001 | Ga0075370_10000001141 | 297 |
| 97 | 3300009147 | Ga0114129_10503085 | Ga0114129_105030853 | 297 |
| 98 | 3300031730 | Ga0307516_10343172 | Ga0307516_103431721 | 297 |
| 99 | 3300050491 | nmdc:mga00v17_4210_c1 | nmdc:mga00v17_4210_c1_5195_6115 | 297 |
| 100 | 3300050493 | nmdc:mga0k408_25112_c1 | nmdc:mga0k408_25112_c1_784_1692 | 297 |
| 101 | 3300050496 | nmdc:mga07m45_2_c1 | nmdc:mga07m45_2_c1_117486_118394 | 297 |
| 102 | 3300037471 | Ga0395905_0209296 | Ga0395905_0209296_448_1398 | 298 |
| 103 | 3300005843 | Ga0068860_100010624 | Ga0068860_1000106242 | 299 |
| 104 | 3300028381 | Ga0268264_10023749 | Ga0268264_100237493 | 299 |
| 105 | 3300031649 | Ga0307514_10025131 | Ga0307514_100251313 | 299 |
| 106 | iso_pu_bacteria | 2643221579 | 2643906127 | 299 |
| 107 | 3300005331 | Ga0070670_100000339 | Ga0070670_10000033929 | 300 |
| 108 | 3300005367 | Ga0070667_100016634 | Ga0070667_1000166342 | 300 |
| 109 | 3300005937 | Ga0081455_10004575 | Ga0081455_1000457523 | 300 |
| 110 | 3300014969 | Ga0157376_10002016 | Ga0157376_100020164 | 300 |
| 111 | 3300002459 | JGI24751J29686_10000437 | JGI24751J29686_1000043715 | 301 |
| 112 | 3300005335 | Ga0070666_10012350 | Ga0070666_100123502 | 301 |
| 113 | 3300005347 | Ga0070668_100108031 | Ga0070668_1001080312 | 301 |
| 114 | 3300005364 | Ga0070673_100104849 | Ga0070673_1001048492 | 301 |
| 115 | 3300005618 | Ga0068864_100000379 | Ga0068864_10000037915 | 301 |
| 116 | 3300005719 | Ga0068861_100070353 | Ga0068861_1000703531 | 301 |
| 117 | 3300005841 | Ga0068863_100221723 | Ga0068863_1002217232 | 301 |
| 118 | 3300006881 | Ga0068865_100006442 | Ga0068865_1000064424 | 301 |
| 119 | 3300009553 | Ga0105249_10252332 | Ga0105249_102523321 | 301 |
| 120 | 3300013296 | Ga0157374_10046365 | Ga0157374_100463652 | 301 |
| 121 | 3300013308 | Ga0157375_10000667 | Ga0157375_1000066712 | 301 |
| 122 | 3300014326 | Ga0157380_10003365 | Ga0157380_100033653 | 301 |
| 123 | 3300025903 | Ga0207680_10150910 | Ga0207680_101509102 | 301 |
| 124 | 3300025925 | Ga0207650_10000008 | Ga0207650_10000008431 | 301 |
| 125 | 3300025934 | Ga0207686_10195163 | Ga0207686_101951632 | 301 |
| 126 | 3300025938 | Ga0207704_10004224 | Ga0207704_100042244 | 301 |
| 127 | 3300025960 | Ga0207651_10076661 | Ga0207651_100766612 | 301 |
| 128 | 3300025972 | Ga0207668_10175725 | Ga0207668_101757251 | 301 |
| 129 | 3300025986 | Ga0207658_10001804 | Ga0207658_100018046 | 301 |
| 130 | 3300026095 | Ga0207676_10000264 | Ga0207676_1000026433 | 301 |
| 131 | 3300026118 | Ga0207675_100090136 | Ga0207675_1000901364 | 301 |
| 132 | 3300049822 | Ga0501035_0004589 | Ga0501035_0004589_5632_6651 | 301 |
| 133 | 3300002239 | JGI24034J26672_10012110 | JGI24034J26672_100121101 | 302 |
| 134 | 3300002459 | JGI24751J29686_10003571 | JGI24751J29686_100035712 | 302 |
| 135 | 3300005331 | Ga0070670_100002660 | Ga0070670_10000266010 | 302 |
| 136 | 3300005347 | Ga0070668_100002607 | Ga0070668_1000026074 | 302 |
| 137 | 3300005353 | Ga0070669_100078825 | Ga0070669_1000788251 | 302 |
| 138 | 3300005355 | Ga0070671_100000027 | Ga0070671_100000027117 | 302 |
| 139 | 3300005367 | Ga0070667_100000004 | Ga0070667_10000000442 | 302 |
| 140 | 3300005617 | Ga0068859_100039748 | Ga0068859_1000397485 | 302 |
| 141 | 3300005841 | Ga0068863_100007183 | Ga0068863_1000071834 | 302 |
| 142 | 3300005842 | Ga0068858_100021339 | Ga0068858_1000213396 | 302 |
| 143 | 3300005843 | Ga0068860_100000002 | Ga0068860_10000000227 | 302 |
| 144 | 3300005844 | Ga0068862_100002573 | Ga0068862_1000025738 | 302 |
| 145 | 3300006931 | Ga0097620_100039748 | Ga0097620_1000397485 | 302 |
| 146 | 3300025923 | Ga0207681_10006088 | Ga0207681_100060882 | 302 |
| 147 | 3300025925 | Ga0207650_10002924 | Ga0207650_100029247 | 302 |
| 148 | 3300025931 | Ga0207644_10000064 | Ga0207644_1000006433 | 302 |
| 149 | 3300025972 | Ga0207668_10000024 | Ga0207668_10000024112 | 302 |
| 150 | 3300025986 | Ga0207658_10000002 | Ga0207658_10000002334 | 302 |
| 151 | 3300026035 | Ga0207703_10009769 | Ga0207703_100097692 | 302 |
| 152 | 3300026088 | Ga0207641_10000475 | Ga0207641_1000047541 | 302 |
| 153 | 3300028380 | Ga0268265_10000204 | Ga0268265_1000020436 | 302 |
| 154 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001659 | 302 |
| 155 | 3300049571 | Ga0501034_0010037 | Ga0501034_0010037_6524_7555 | 302 |
| 156 | 3300049579 | Ga0501043_0007933 | Ga0501043_0007933_2613_3644 | 302 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u9y-assembly1.cif.gz_A | crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii | 0.8957 | 4 | 283 |
| 8dbo-assembly1.cif.gz_A | human prps1-e307a engineered mutation with adp; hexamer | 0.8905 | 3 | 285 |
| 8dbe-assembly1.cif.gz_A | human prps1 with adp; hexamer | 0.89 | 3 | 285 |
| 4twb-assembly3.cif.gz_E | sulfolobus solfataricus ribose-phosphate pyrophosphokinase | 0.8885 | 4 | 276 |
| 1u9y-assembly1.cif.gz_A | crystal structure of phosphoribosyl diphosphate synthase from methanocaldococcus jannaschii | 0.8832 | 4 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3mbiA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.904 | 1 | 145 | 3.40.50.2020 |
| af_P9WKE3_10_163_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8985 | 1 | 155 | 3.40.50.2020 |
| af_P87171_7_220_3.40.50.10090 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8976 | 6 | 193 | 3.40.50.10090 |
| af_Q2G0S2_14_197_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8972 | 6 | 185 | 3.40.50.2020 |
| 1u9yA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8962 | 4 | 145 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2X1ALS2-F1-model_v4 | ribose-phosphate diphosphokinase (EC 2.7.6.1) | 0.9748 | 2 | 292 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
| AF-A0A7X7PSU1-F1-model_v4 | Ribose-phosphate pyrophosphokinase | 0.9684 | 1 | 285 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
| AF-A0A3D2L8D8-F1-model_v4 | ribose-phosphate diphosphokinase (EC 2.7.6.1) | 0.9667 | 2 | 168 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
| AF-A0A2Z6E5K9-F1-model_v4 | Ribose-phosphate pyrophosphokinase | 0.9649 | 1 | 285 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
| AF-X1CG91-F1-model_v4 | ribose-phosphate diphosphokinase (EC 2.7.6.1) | 0.9624 | 1 | 152 |
GO:0000287
GO:0002189 GO:0004749 GO:0005737 GO:0006015 GO:0006164 GO:0016301 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar