F225691

General Info

Members Datasets Scaffolds Average Seq Length
156 130 150 217

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0073592|Ga0495680_0073592_1315_2037
Length 240
Sequence LPIALSGTCWHHSGKLNQESAMPTSPTITAFERSPDRGRGLARDMRVRWAFEEVGQPYEVRLLSFEAMKQPAHLARNPFGQIPTYEEGELTLFESGAIVMRIAEQHPGLLPPDAHARARAIMWMFAALNTVEPPIVDRMMAILVEGKESWAQQRQAAIEERIRKRLAELAFHLGDGEWLDSQFSAGDLLMVTVLRRLTGSGLIEEQPAIAAYIARAEARPAYQRAFEAQLAVFKVTQTEN

Samples

Sample ID Description Type Environment
1 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
2 2941471342 Luteibacter sp. 621 Isolate Unclassified
3 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
4 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
5 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
6 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
78 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
79 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
80 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
81 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
86 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
87 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
102 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
103 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
111 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
112 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
113 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
114 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
115 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
116 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
124 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
125 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.15
Metatranscriptomes 0
Isolates 3.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 1.92
Rhizoplane 2.56
Rhizosphere 71.79
Stem 0
Stem Tuber 0
Unclassified 11.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007218 3300001979 Bacteria 4530
2 JGI25165J46597_1000021 3300003214 Bacteria 359288
3 JGI25153J46596_10046141 3300003215 Bacteria 1293
4 Ga0055530_10000806 3300003791 Bacteria 26041
5 Ga0055540_1000001 3300003792 Bacteria 466834
6 Ga0070689_100004906 3300005340 Bacteria 9076
7 Ga0070661_100850181 3300005344 Bacteria 751
8 Ga0070669_100000076 3300005353 Bacteria 97334
9 Ga0070675_100024446 3300005354 Bacteria 4837
10 Ga0070688_100000418 3300005365 Bacteria 21525
11 Ga0070685_10000166 3300005466 Bacteria 43492
12 Ga0070684_100098952 3300005535 Bacteria 2602
13 Ga0068853_100317587 3300005539 Bacteria 1443
14 Ga0070665_100000019 3300005548 Bacteria 413972
15 Ga0070665_100000105 3300005548 Bacteria 157734
16 Ga0070665_100000412 3300005548 Bacteria 62584
17 Ga0068855_100298586 3300005563 Bacteria 1784
18 Ga0068852_100505087 3300005616 Bacteria 1204
19 Ga0068859_100023460 3300005617 Bacteria 6191
20 Ga0068863_100000118 3300005841 Bacteria 82651
21 Ga0068858_100015884 3300005842 Bacteria 7075
22 Ga0068862_100251177 3300005844 Bacteria 1612
23 Ga0081455_10064241 3300005937 Bacteria 3075
24 Ga0075365_10164916 3300006038 Bacteria 1545
25 Ga0075363_100150425 3300006048 Bacteria 1314
26 Ga0075366_10078056 3300006195 Bacteria 1976
27 Ga0097620_100023462 3300006931 Bacteria 6191
28 Ga0105247_10008932 3300009101 Bacteria 6107
29 Ga0105237_10524867 3300009545 Bacteria 1191
30 Ga0105238_10022033 3300009551 Bacteria 6494
31 Ga0105238_10070019 3300009551 Bacteria 3508
32 Ga0105238_10131313 3300009551 Bacteria 2483
33 Ga0105238_10354690 3300009551 Bacteria 1456
34 Ga0105238_10804905 3300009551 Bacteria 955
35 Ga0157370_10108087 3300013104 Bacteria 2601
36 Ga0157369_10036586 3300013105 Bacteria 5377
37 Ga0157372_10008500 3300013307 Bacteria 10896
38 Ga0157380_10003165 3300014326 Bacteria 11233
39 Ga0157379_10019339 3300014968 Bacteria 6015
40 Ga0213876_10000201 3300021384 Bacteria 61091
41 Ga0209233_1000065 3300025261 Bacteria 387195
42 Ga0209050_1000145 3300025298 Bacteria 168151
43 Ga0209051_1000018 3300025303 Bacteria 527061
44 Ga0209257_1000084 3300025304 Bacteria 291502
45 Ga0207647_10000020 3300025904 Bacteria 123888
46 Ga0207647_10006932 3300025904 Bacteria 8211
47 Ga0207654_10012438 3300025911 Bacteria 4360
48 Ga0207671_10001562 3300025914 Bacteria 26186
49 Ga0207657_10472851 3300025919 Bacteria 983
50 Ga0207681_10000765 3300025923 Bacteria 21139
51 Ga0207694_10027155 3300025924 Bacteria 4359
52 Ga0207670_10012566 3300025936 Bacteria 4959
53 Ga0207640_10113227 3300025981 Bacteria 1928
54 Ga0207703_10002487 3300026035 Bacteria 15983
55 Ga0207639_10579530 3300026041 Bacteria 1033
56 Ga0207639_10670847 3300026041 Bacteria 960
57 Ga0207702_10013464 3300026078 Bacteria 6798
58 Ga0207641_10000101 3300026088 Bacteria 122493
59 Ga0207674_10229399 3300026116 Bacteria 1804
60 Ga0207698_10102328 3300026142 Bacteria 2377
61 Ga0268266_10000025 3300028379 Bacteria 477143
62 Ga0268266_10000055 3300028379 Bacteria 291630
63 Ga0268266_10000642 3300028379 Bacteria 47516
64 Ga0307513_10287126 3300031456 Bacteria 1419
65 Ga0307513_10366530 3300031456 Bacteria 1184
66 Ga0265313_10016912 3300031595 Bacteria 4173
67 Ga0307405_10004054 3300031731 Bacteria 6878
68 Ga0307405_10189814 3300031731 Bacteria 1483
69 Ga0307413_10028415 3300031824 Bacteria 3114
70 Ga0307410_10025805 3300031852 Bacteria 3691
71 Ga0307410_10311169 3300031852 Bacteria 1246
72 Ga0307406_10225618 3300031901 Bacteria 1395
73 Ga0307407_10009646 3300031903 Bacteria 4507
74 Ga0307407_10239793 3300031903 Bacteria 1236
75 Ga0307412_10005989 3300031911 Bacteria 6850
76 Ga0307409_100386526 3300031995 Bacteria 1332
77 Ga0307416_100002230 3300032002 Bacteria 11029
78 Ga0307414_10002296 3300032004 Bacteria 9996
79 Ga0307414_10063005 3300032004 Bacteria 2634
80 Ga0307414_10103876 3300032004 Bacteria 2145
81 Ga0307414_10429718 3300032004 Bacteria 1153
82 Ga0307414_10458550 3300032004 Bacteria 1119
83 Ga0307414_10912845 3300032004 Bacteria 805
84 Ga0307411_10010203 3300032005 Bacteria 4994
85 Ga0436365_1073490 3300039437 Bacteria 73987
86 Ga0453684_0145761 3300044712 Bacteria 2821
87 Ga0451576_1618495 3300045051 Bacteria 671
88 Ga0466958_0689703 3300045836 Bacteria 665
89 Ga0495653_0092167 3300046463 Bacteria 2213
90 Ga0495584_0212855 3300046491 Bacteria 982
91 Ga0495585_0067625 3300046492 Bacteria 1953
92 Ga0495585_0067758 3300046492 Bacteria 1951
93 Ga0495596_0025508 3300046500 Bacteria 2389
94 Ga0495607_0024825 3300046501 Bacteria 3732
95 Ga0495583_0000160 3300046506 Bacteria 113560
96 Ga0495616_0038470 3300046513 Bacteria 2455
97 Ga0495631_0005283 3300046518 Bacteria 6784
98 Ga0495632_0008233 3300046519 Bacteria 6429
99 Ga0495643_0001396 3300046522 Bacteria 22518
100 Ga0495644_0058613 3300046523 Bacteria 1447
101 Ga0495644_0070035 3300046523 Bacteria 1318
102 Ga0495642_0029339 3300046528 Bacteria 2195
103 Ga0495640_0170950 3300046533 Bacteria 1389
104 Ga0495633_0000162 3300046558 Bacteria 87434
105 Ga0495611_0002184 3300046648 Bacteria 9114
106 Ga0495625_0053558 3300046660 Bacteria 2885
107 Ga0495647_0005335 3300046681 Bacteria 4209
108 Ga0495669_0012828 3300046684 Bacteria 3567
109 Ga0495670_0074633 3300046691 Bacteria 1721
110 Ga0495589_0030540 3300046794 Bacteria 2713
111 Ga0495660_0032472 3300046810 Bacteria 2931
112 Ga0495680_0073592 3300047322 Bacteria 2596
113 Ga0495680_0113315 3300047322 Bacteria 2008
114 Ga0495683_0246363 3300047323 Bacteria 786
115 Ga0495679_010763 3300047446 Bacteria 3570
116 Ga0495686_0001386 3300047472 Bacteria 26897
117 Ga0495615_0093325 3300048090 Bacteria 841
118 Ga0495626_0011710 3300048091 Bacteria 4627
119 Ga0496102_0083643 3300048905 Bacteria 2944
120 Ga0496103_0015812 3300048906 Bacteria 4498
121 Ga0496109_0044081 3300048912 Bacteria 4046
122 Ga0496115_0330352 3300048918 Bacteria 1246
123 Ga0496116_0039689 3300048919 Bacteria 3251
124 Ga0496117_0012050 3300048920 Bacteria 7675
125 Ga0496118_0000307 3300048921 Bacteria 85093
126 Ga0496121_0000108 3300048924 Bacteria 188757
127 Ga0496122_0056410 3300048925 Bacteria 2928
128 Ga0496123_0047087 3300048926 Bacteria 2917
129 Ga0496124_0211771 3300048927 Bacteria 1466
130 Ga0496124_0402450 3300048927 Bacteria 950
131 Ga0496125_0018688 3300048928 Bacteria 6573
132 Ga0496126_0023727 3300048929 Bacteria 5940
133 Ga0496126_0245680 3300048929 Bacteria 1493
134 Ga0495678_005882 3300049459 Bacteria 6639
135 Ga0501046_0538774 3300049580 Bacteria 833
136 Ga0501047_0021004 3300049581 Bacteria 6271
137 Ga0501048_0450158 3300049582 Bacteria 922
138 Ga0501070_0058387 3300049586 Bacteria 3198
139 Ga0501070_0549751 3300049586 Bacteria 924
140 Ga0501035_0035286 3300049822 Bacteria 4539
141 Ga0501035_0063511 3300049822 Bacteria 3284
142 Ga0501044_0013540 3300049823 Bacteria 8817
143 nmdc:mga03n38_192448_c1 3300050490 Bacteria 1051
144 nmdc:mga0yw44_109957_c1 3300050492 Bacteria 1765
145 nmdc:mga07m45_428226_c1 3300050496 Bacteria 767
146 Ga0500562_021972 3300053108 Bacteria 1662
147 Ga0500595_006633 3300053119 Bacteria 4885
148 Ga0500559_0000693 3300053136 Bacteria 22159
149 Ga0500616_0000123 3300053153 Bacteria 140214
150 Ga0500587_000236 3300053739 Bacteria 5920

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_10022033 Ga0105238_100220333 196
2 3300009551 Ga0105238_10354690 Ga0105238_103546902 196
3 3300013307 Ga0157372_10008500 Ga0157372_100085009 196
4 3300045836 Ga0466958_0689703 Ga0466958_0689703_40_630 196
5 3300046681 Ga0495647_0005335 Ga0495647_0005335_233_898 196
6 3300047472 Ga0495686_0001386 Ga0495686_0001386_650_1240 196
7 3300048929 Ga0496126_0245680 Ga0496126_0245680_12_611 199
8 3300045051 Ga0451576_1618495 Ga0451576_1618495_37_642 201
9 3300005548 Ga0070665_100000412 Ga0070665_10000041285 204
10 3300028379 Ga0268266_10000642 Ga0268266_1000064251 204
11 3300031901 Ga0307406_10225618 Ga0307406_102256182 210
12 iso_pu_bacteria 3000135777 3000140022 210
13 3300005353 Ga0070669_100000076 Ga0070669_100000076104 211
14 3300005842 Ga0068858_100015884 Ga0068858_1000158845 211
15 3300025923 Ga0207681_10000765 Ga0207681_1000076510 211
16 3300026035 Ga0207703_10002487 Ga0207703_100024879 211
17 3300005563 Ga0068855_100298586 Ga0068855_1002985862 212
18 3300021384 Ga0213876_10000201 Ga0213876_1000020125 212
19 3300039437 Ga0436365_1073490 Ga0436365_1073490_37133_37771 212
20 3300046533 Ga0495640_0170950 Ga0495640_0170950_535_1206 212
21 3300047322 Ga0495680_0113315 Ga0495680_0113315_218_889 212
22 3300049822 Ga0501035_0035286 Ga0501035_0035286_2646_3284 212
23 iso_pu_bacteria 2919171160 2919174318 212
24 iso_pu_bacteria 2941471342 2941474561 212
25 iso_pu_bacteria 2960603979 2960606153 212
26 iso_pu_bacteria 2967693043 2967693960 212
27 iso_pu_bacteria 2970129317 2970130735 212
28 3300044712 Ga0453684_0145761 Ga0453684_0145761_1943_2584 213
29 3300049580 Ga0501046_0538774 Ga0501046_0538774_163_819 213
30 3300049581 Ga0501047_0021004 Ga0501047_0021004_5256_5897 213
31 3300049582 Ga0501048_0450158 Ga0501048_0450158_37_678 213
32 3300049586 Ga0501070_0058387 Ga0501070_0058387_904_1545 213
33 3300049586 Ga0501070_0549751 Ga0501070_0549751_151_792 213
34 3300049822 Ga0501035_0063511 Ga0501035_0063511_1681_2325 213
35 3300049823 Ga0501044_0013540 Ga0501044_0013540_7806_8450 213
36 3300005937 Ga0081455_10064241 Ga0081455_100642412 214
37 3300026041 Ga0207639_10579530 Ga0207639_105795302 214
38 3300031595 Ga0265313_10016912 Ga0265313_100169127 214
39 3300003214 JGI25165J46597_1000021 JGI25165J46597_1000021305 215
40 3300005844 Ga0068862_100251177 Ga0068862_1002511773 215
41 3300006048 Ga0075363_100150425 Ga0075363_1001504251 215
42 3300025261 Ga0209233_1000065 Ga0209233_1000065306 215
43 3300046558 Ga0495633_0000162 Ga0495633_0000162_22254_22901 215
44 3300048090 Ga0495615_0093325 Ga0495615_0093325_69_716 215
45 3300048925 Ga0496122_0056410 Ga0496122_0056410_141_788 215
46 3300048926 Ga0496123_0047087 Ga0496123_0047087_113_760 215
47 3300048927 Ga0496124_0402450 Ga0496124_0402450_14_661 215
48 3300050490 nmdc:mga03n38_192448_c1 nmdc:mga03n38_192448_c1_238_885 215
49 3300003215 JGI25153J46596_10046141 JGI25153J46596_100461411 216
50 3300003791 Ga0055530_10000806 Ga0055530_1000080620 216
51 3300003792 Ga0055540_1000001 Ga0055540_1000001197 216
52 3300005535 Ga0070684_100098952 Ga0070684_1000989521 216
53 3300005539 Ga0068853_100317587 Ga0068853_1003175872 216
54 3300005616 Ga0068852_100505087 Ga0068852_1005050871 216
55 3300006038 Ga0075365_10164916 Ga0075365_101649162 216
56 3300006195 Ga0075366_10078056 Ga0075366_100780562 216
57 3300009545 Ga0105237_10524867 Ga0105237_105248671 216
58 3300013104 Ga0157370_10108087 Ga0157370_101080873 216
59 3300013105 Ga0157369_10036586 Ga0157369_100365863 216
60 3300025298 Ga0209050_1000145 Ga0209050_100014570 216
61 3300025303 Ga0209051_1000018 Ga0209051_1000018255 216
62 3300025304 Ga0209257_1000084 Ga0209257_1000084117 216
63 3300025904 Ga0207647_10000020 Ga0207647_1000002041 216
64 3300025904 Ga0207647_10006932 Ga0207647_100069325 216
65 3300025911 Ga0207654_10012438 Ga0207654_100124383 216
66 3300025914 Ga0207671_10001562 Ga0207671_1000156231 216
67 3300025981 Ga0207640_10113227 Ga0207640_101132272 216
68 3300026041 Ga0207639_10670847 Ga0207639_106708471 216
69 3300026078 Ga0207702_10013464 Ga0207702_100134642 216
70 3300026142 Ga0207698_10102328 Ga0207698_101023281 216
71 3300032004 Ga0307414_10912845 Ga0307414_109128451 216
72 3300046491 Ga0495584_0212855 Ga0495584_0212855_157_807 216
73 3300046492 Ga0495585_0067758 Ga0495585_0067758_1264_1914 216
74 3300046523 Ga0495644_0070035 Ga0495644_0070035_496_1146 216
75 3300046660 Ga0495625_0053558 Ga0495625_0053558_302_952 216
76 3300047323 Ga0495683_0246363 Ga0495683_0246363_102_752 216
77 3300048919 Ga0496116_0039689 Ga0496116_0039689_1349_1999 216
78 3300048920 Ga0496117_0012050 Ga0496117_0012050_1649_2299 216
79 3300048921 Ga0496118_0000307 Ga0496118_0000307_26000_26650 216
80 3300048924 Ga0496121_0000108 Ga0496121_0000108_115670_116320 216
81 3300048928 Ga0496125_0018688 Ga0496125_0018688_4929_5579 216
82 3300048929 Ga0496126_0023727 Ga0496126_0023727_2242_2892 216
83 3300050492 nmdc:mga0yw44_109957_c1 nmdc:mga0yw44_109957_c1_1005_1655 216
84 3300050496 nmdc:mga07m45_428226_c1 nmdc:mga07m45_428226_c1_64_714 216
85 3300053108 Ga0500562_021972 Ga0500562_021972_985_1635 216
86 3300005340 Ga0070689_100004906 Ga0070689_1000049069 217
87 3300005344 Ga0070661_100850181 Ga0070661_1008501811 217
88 3300005354 Ga0070675_100024446 Ga0070675_1000244467 217
89 3300005365 Ga0070688_100000418 Ga0070688_1000004184 217
90 3300005466 Ga0070685_10000166 Ga0070685_1000016617 217
91 3300005548 Ga0070665_100000019 Ga0070665_100000019165 217
92 3300005617 Ga0068859_100023460 Ga0068859_1000234602 217
93 3300005841 Ga0068863_100000118 Ga0068863_1000001182 217
94 3300006931 Ga0097620_100023462 Ga0097620_1000234625 217
95 3300009101 Ga0105247_10008932 Ga0105247_100089325 217
96 3300009551 Ga0105238_10804905 Ga0105238_108049051 217
97 3300014326 Ga0157380_10003165 Ga0157380_100031654 217
98 3300014968 Ga0157379_10019339 Ga0157379_100193393 217
99 3300025919 Ga0207657_10472851 Ga0207657_104728511 217
100 3300025936 Ga0207670_10012566 Ga0207670_100125662 217
101 3300026088 Ga0207641_10000101 Ga0207641_10000101148 217
102 3300026116 Ga0207674_10229399 Ga0207674_102293992 217
103 3300028379 Ga0268266_10000025 Ga0268266_10000025330 217
104 3300031456 Ga0307513_10287126 Ga0307513_102871261 217
105 3300032004 Ga0307414_10429718 Ga0307414_104297182 217
106 3300046463 Ga0495653_0092167 Ga0495653_0092167_311_970 217
107 3300047322 Ga0495680_0073592 Ga0495680_0073592_1315_2037 217
108 3300048905 Ga0496102_0083643 Ga0496102_0083643_621_1295 217
109 3300048906 Ga0496103_0015812 Ga0496103_0015812_1829_2503 217
110 3300048912 Ga0496109_0044081 Ga0496109_0044081_2054_2713 217
111 3300048918 Ga0496115_0330352 Ga0496115_0330352_159_818 217
112 3300048927 Ga0496124_0211771 Ga0496124_0211771_92_745 217
113 3300053119 Ga0500595_006633 Ga0500595_006633_1554_2207 217
114 3300053136 Ga0500559_0000693 Ga0500559_0000693_7127_7780 217
115 3300005548 Ga0070665_100000105 Ga0070665_10000010558 218
116 3300028379 Ga0268266_10000055 Ga0268266_10000055260 218
117 3300009551 Ga0105238_10131313 Ga0105238_101313131 220
118 3300031456 Ga0307513_10366530 Ga0307513_103665302 220
119 3300053153 Ga0500616_0000123 Ga0500616_0000123_33177_33842 220
120 3300053739 Ga0500587_000236 Ga0500587_000236_3334_3999 220
121 3300046492 Ga0495585_0067625 Ga0495585_0067625_627_1295 222
122 3300046500 Ga0495596_0025508 Ga0495596_0025508_913_1581 222
123 3300046501 Ga0495607_0024825 Ga0495607_0024825_2438_3106 222
124 3300046506 Ga0495583_0000160 Ga0495583_0000160_45378_46046 222
125 3300046513 Ga0495616_0038470 Ga0495616_0038470_1590_2258 222
126 3300046518 Ga0495631_0005283 Ga0495631_0005283_2406_3074 222
127 3300046519 Ga0495632_0008233 Ga0495632_0008233_3288_3956 222
128 3300046522 Ga0495643_0001396 Ga0495643_0001396_310_978 222
129 3300046523 Ga0495644_0058613 Ga0495644_0058613_121_789 222
130 3300046528 Ga0495642_0029339 Ga0495642_0029339_674_1342 222
131 3300046648 Ga0495611_0002184 Ga0495611_0002184_8096_8764 222
132 3300046684 Ga0495669_0012828 Ga0495669_0012828_864_1532 222
133 3300046691 Ga0495670_0074633 Ga0495670_0074633_288_956 222
134 3300046794 Ga0495589_0030540 Ga0495589_0030540_1032_1700 222
135 3300046810 Ga0495660_0032472 Ga0495660_0032472_2119_2787 222
136 3300047446 Ga0495679_010763 Ga0495679_010763_2244_2912 222
137 3300048091 Ga0495626_0011710 Ga0495626_0011710_1141_1809 222
138 3300049459 Ga0495678_005882 Ga0495678_005882_1047_1715 222
139 3300001979 JGI24740J21852_10007218 JGI24740J21852_100072186 223
140 3300009551 Ga0105238_10070019 Ga0105238_100700192 223
141 3300025924 Ga0207694_10027155 Ga0207694_100271553 223
142 3300031731 Ga0307405_10004054 Ga0307405_100040549 223
143 3300031731 Ga0307405_10189814 Ga0307405_101898142 223
144 3300031824 Ga0307413_10028415 Ga0307413_100284154 223
145 3300031852 Ga0307410_10025805 Ga0307410_100258055 223
146 3300031852 Ga0307410_10311169 Ga0307410_103111692 223
147 3300031903 Ga0307407_10009646 Ga0307407_100096467 223
148 3300031903 Ga0307407_10239793 Ga0307407_102397932 223
149 3300031911 Ga0307412_10005989 Ga0307412_1000598910 223
150 3300031995 Ga0307409_100386526 Ga0307409_1003865262 223
151 3300032002 Ga0307416_100002230 Ga0307416_1000022308 223
152 3300032004 Ga0307414_10002296 Ga0307414_100022962 223
153 3300032004 Ga0307414_10063005 Ga0307414_100630052 223
154 3300032004 Ga0307414_10103876 Ga0307414_101038762 223
155 3300032004 Ga0307414_10458550 Ga0307414_104585502 223
156 3300032005 Ga0307411_10010203 Ga0307411_100102035 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

44

110

0.94

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

37

104

0.9

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

45

105

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ycd-assembly1.cif.gz_A-2 structure of a novel glutathione transferase from agrobacterium tumefaciens. 0.9857 2 209
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9819 1 210
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.979 1 210
3lq7-assembly1.cif.gz_A crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9695 1 210
3lq7-assembly1.cif.gz_B crystal structure of glutathione s-transferase from agrobacterium tumefaciens str. c58 0.9672 1 210
ID Description Score Start End Superfamily
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9914 2 85 3.40.30.10
2ycdA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9909 2 85 3.40.30.10
3lq7A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9784 2 85 3.40.30.10
2ycdA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9745 86 201 1.20.1050.10
3lq7B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9709 86 201 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A527H6A2-F1-model_v4 Glutathione S-transferase 0.9969 1 147 GO:0016740
AF-A0A529NGU8-F1-model_v4 Glutathione S-transferase 0.9954 1 106 GO:0016740
AF-A0A7W6WI89-F1-model_v4 Glutathione S-transferase (EC 2.5.1.18) 0.9936 1 208 GO:0004364
AF-A0A534EIW3-F1-model_v4 Glutathione S-transferase family protein 0.9935 48 207 GO:0016740
AF-A0A249P3N1-F1-model_v4 Glutathione S-transferase 0.993 1 210 GO:0016740

Feature Viewer

pLDDT pTM Quality
91.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map