F225361

General Info

Members Datasets Scaffolds Average Seq Length
156 120 312 218

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0723260|Ga0436364_0723260_11323_12054
Length 243
Sequence LFVRPFALSGDRGVQSAYLRDGAFAGRSNVTIDAKICGLSSEDAVAAAVEGGAAYIGFVFYPRSPRSVTPERARALCDRIPVSVRRVGLFVDASDDEIAAVLDAAPIDLLQLHGHESAERIAAVKRRFGRPIMKAIAIAGENDLPAAAAYEDAADMLLFDAKPPRREGALPGGNGLTFDWRLLAGRRWQRPWMLSGGLTADLLPEAVRISGATAVDVSSGVEHRAGEKDPGKIREFLARARQL

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
20 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
36 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
38 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
43 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
44 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
51 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
52 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
53 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
54 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
55 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
56 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
57 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
59 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
60 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
63 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
68 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
73 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
82 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
83 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
87 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
88 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
89 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
90 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
91 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
92 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
100 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
103 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
104 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
107 2508501050 Microvirga lupini Lut6 Isolate Nodule
108 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
109 2773857925 Microvirga vignae BR3299 Isolate Unclassified
110 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
111 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
112 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
113 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
114 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
115 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
116 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
117 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
118 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
119 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
120 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.03
Metatranscriptomes 0
Isolates 8.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.56
Rhizoplane 0
Rhizosphere 87.18
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0723260 3300037853 Bacteria 46751
2 Ga0070670_100599878 3300005331 Bacteria 985
3 Ga0070671_100176725 3300005355 Bacteria 1807
4 Ga0070678_100892771 3300005456 Bacteria 812
5 Ga0070706_100030708 3300005467 Bacteria 4952
6 Ga0070706_100229381 3300005467 Bacteria 1733
7 Ga0070707_100041263 3300005468 Bacteria 4416
8 Ga0070698_100153324 3300005471 Bacteria 2250
9 Ga0070686_100067996 3300005544 Bacteria 2323
10 Ga0068859_100367510 3300005617 Bacteria 1534
11 Ga0070717_10035855 3300006028 Bacteria 4019
12 Ga0070712_100055603 3300006175 Bacteria 2772
13 Ga0070712_100059501 3300006175 Bacteria 2691
14 Ga0070712_100195182 3300006175 Bacteria 1587
15 Ga0075431_101098798 3300006847 Bacteria 760
16 Ga0068865_100357308 3300006881 Bacteria 1185
17 Ga0097620_100367502 3300006931 Bacteria 1534
18 Ga0111539_10001432 3300009094 Bacteria 31830
19 Ga0105246_10307958 3300011119 Bacteria 1282
20 Ga0163162_10434228 3300013306 Bacteria 1445
21 Ga0163163_10134999 3300014325 Bacteria 2508
22 Ga0157380_10192237 3300014326 Bacteria 1803
23 Ga0157379_10237575 3300014968 Bacteria 1652
24 Ga0157379_10626416 3300014968 Bacteria 1006
25 Ga0213875_10001472 3300021388 Bacteria 15207
26 Ga0207692_10015023 3300025898 Bacteria 3398
27 Ga0207643_10202445 3300025908 Bacteria 1209
28 Ga0207684_10025783 3300025910 Bacteria 5009
29 Ga0207684_10116047 3300025910 Bacteria 2294
30 Ga0207693_10294219 3300025915 Bacteria 1272
31 Ga0207646_10057363 3300025922 Bacteria 3479
32 Ga0207659_10223803 3300025926 Bacteria 1514
33 Ga0207700_10125205 3300025928 Bacteria 2090
34 Ga0207664_10059903 3300025929 Bacteria 3034
35 Ga0207644_10029850 3300025931 Bacteria 3785
36 Ga0207669_10159411 3300025937 Bacteria 1592
37 Ga0207668_10249796 3300025972 Bacteria 1440
38 Ga0207658_10239272 3300025986 Bacteria 1537
39 Ga0207674_10432595 3300026116 Bacteria 1272
40 Ga0207428_10000071 3300027907 Bacteria 144369
41 Ga0268266_10695253 3300028379 Bacteria 980
42 Ga0265316_10216133 3300031344 Bacteria 1416
43 Ga0307513_10278678 3300031456 Bacteria 1451
44 Ga0307408_100201056 3300031548 Bacteria 1613
45 Ga0307408_100212967 3300031548 Bacteria 1571
46 Ga0265314_10226757 3300031711 Bacteria 1086
47 Ga0316576_10113820 3300031727 Bacteria 2029
48 Ga0307405_10038074 3300031731 Bacteria 2896
49 Ga0307413_10047631 3300031824 Bacteria 2557
50 Ga0307410_10009734 3300031852 Bacteria 5406
51 Ga0307409_100066414 3300031995 Bacteria 2844
52 Ga0307409_100584032 3300031995 Bacteria 1102
53 Ga0307416_100098476 3300032002 Bacteria 2536
54 Ga0307414_10084839 3300032004 Bacteria 2331
55 Ga0307411_10175846 3300032005 Bacteria 1620
56 Ga0307415_100125673 3300032126 Bacteria 1932
57 Ga0307415_100332695 3300032126 Bacteria 1271
58 Ga0316583_10080487 3300032133 Bacteria 1138
59 Ga0373923_0196264 3300035111 Bacteria 932
60 Ga0373953_0007684 3300035117 Bacteria 3623
61 Ga0373954_0008519 3300035118 Bacteria 4503
62 Ga0373956_0019763 3300035119 Bacteria 2860
63 Ga0373955_0087566 3300035172 Bacteria 1770
64 Ga0373924_0155692 3300035410 Unclassified 1001
65 Ga0373935_0069198 3300035692 Bacteria 2273
66 Ga0373933_0060466 3300035724 Bacteria 2284
67 Ga0373937_0013121 3300036401 Bacteria 7297
68 Ga0373937_0031661 3300036401 Bacteria 4794
69 Ga0316584_0020995 3300036712 Bacteria 4743
70 Ga0395898_0333063 3300037466 Bacteria 1447
71 Ga0436364_0305351 3300037853 Bacteria 4602
72 Ga0436364_0449559 3300037853 Bacteria 73062
73 Ga0436364_0465737 3300037853 Bacteria 1985
74 Ga0400483_030595 3300039062 Bacteria 2657
75 Ga0436365_0756618 3300039437 Bacteria 1186
76 Ga0436365_0873163 3300039437 Bacteria 1878
77 Ga0436365_1234939 3300039437 Unclassified 897
78 Ga0436361_0007320 3300039447 Bacteria 1430
79 Ga0436361_0272285 3300039447 Bacteria 2754
80 Ga0436361_1143045 3300039447 Bacteria 2190
81 Ga0436361_1206550 3300039447 Bacteria 943
82 Ga0436363_0427994 3300039450 Bacteria 2338
83 Ga0436362_0488310 3300039453 Bacteria 998
84 Ga0436362_0740978 3300039453 Unclassified 1012
85 Ga0436362_0829540 3300039453 Bacteria 1918
86 Ga0466972_0205468 3300044658 Bacteria 922
87 Ga0466965_0178790 3300044683 Bacteria 1119
88 Ga0451576_0013396 3300045051 Bacteria 9176
89 Ga0451576_0163306 3300045051 Bacteria 2324
90 Ga0495592_0100989 3300046454 Bacteria 2056
91 Ga0495651_0538937 3300046462 Bacteria 743
92 Ga0495618_0039745 3300046514 Bacteria 2958
93 Ga0495640_0186964 3300046533 Bacteria 1318
94 Ga0495634_0084050 3300046642 Bacteria 2076
95 Ga0495635_0036039 3300046663 Bacteria 3430
96 Ga0495599_0037789 3300046678 Bacteria 3033
97 Ga0495684_0120312 3300047471 Bacteria 1978
98 Ga0501036_0263380 3300049572 Bacteria 1444
99 Ga0501038_0206040 3300049574 Bacteria 1576
100 Ga0501040_0093327 3300049576 Bacteria 2093
101 Ga0501041_0026123 3300049577 Bacteria 3511
102 Ga0501041_0157071 3300049577 Bacteria 1421
103 Ga0501042_0030918 3300049578 Bacteria 3787
104 Ga0501042_0500322 3300049578 Bacteria 882
105 Ga0501042_0569220 3300049578 Bacteria 824
106 Ga0501043_0561488 3300049579 Unclassified 847
107 Ga0501046_0006249 3300049580 Bacteria 10570
108 Ga0501048_0059370 3300049582 Bacteria 2711
109 Ga0501068_0138465 3300049584 Bacteria 1525
110 Ga0501069_0083389 3300049585 Bacteria 1802
111 Ga0501071_0131798 3300049587 Bacteria 1857
112 Ga0501072_0005853 3300049588 Bacteria 9371
113 Ga0501074_0519762 3300049590 Bacteria 843
114 Ga0501075_0122245 3300049591 Bacteria 1981
115 Ga0501075_0254206 3300049591 Bacteria 1339
116 Ga0501075_0672874 3300049591 Bacteria 789
117 Ga0501076_0288564 3300049592 Bacteria 1344
118 Ga0501076_0462653 3300049592 Bacteria 1044
119 Ga0501076_0649217 3300049592 Bacteria 871
120 Ga0501077_0078488 3300049593 Bacteria 2092
121 Ga0501252_000937 3300049682 Bacteria 2524
122 Ga0501079_0021001 3300049741 Bacteria 4991
123 Ga0501079_0156997 3300049741 Bacteria 1773
124 Ga0501080_0670235 3300049742 Bacteria 917
125 Ga0501080_1002420 3300049742 Unclassified 724
126 Ga0501081_0265692 3300049743 Bacteria 1254
127 Ga0501081_0390400 3300049743 Bacteria 1029
128 Ga0501045_0011017 3300049824 Bacteria 6338
129 Ga0501045_0115226 3300049824 Bacteria 1993
130 nmdc:mga06r32_916472_c1 3300050510 Bacteria 832
131 nmdc:mga08y16_32_c1 3300050511 Bacteria 179220
132 nmdc:mga0a205_482706_c1 3300050515 Bacteria 1097
133 Ga0495601_0001859 3300053077 Bacteria 11761
134 Ga0495601_0209759 3300053077 Bacteria 1273
135 Ga0495595_0007951 3300053084 Bacteria 4344
136 Ga0495595_0047993 3300053084 Bacteria 1971
137 Ga0495619_0012096 3300053085 Bacteria 5436
138 Ga0495619_0043808 3300053085 Bacteria 2935
139 Ga0495619_0062834 3300053085 Bacteria 2472
140 Ga0501084_0074544 3300054114 Bacteria 2842
141 Ga0501084_0126989 3300054114 Bacteria 2146
142 Ga0530510_0212185 3300061734 Bacteria 1438
143 2508727069 2508501050 Bacteria 9633614
144 2509074894 2508501114 Bacteria 7082538
145 2774869643 2773857925 Bacteria 6472445
146 2776262775 2775506901 Bacteria 9631051
147 2834578626 2834578030 Bacteria 3530182
148 2835318028 2835312727 Bacteria 7413381
149 2882458412 2882456835 Bacteria 6863978
150 2884301751 2884298095 Bacteria 3823049
151 2894241285 2894232714 Bacteria 8834183
152 2898796768 2898795034 Bacteria 4294459
153 2899261068 2899259804 Bacteria 3320927
154 2919679502 2919679072 Bacteria 4629602
155 3000406969 3000405567 Bacteria 3779330
156 8057135548 8057132660 Bacteria 4061191
157 Ga0436364_0723260
158 Ga0070670_100599878
159 Ga0070671_100176725
160 Ga0070678_100892771
161 Ga0070706_100030708
162 Ga0070706_100229381
163 Ga0070707_100041263
164 Ga0070698_100153324
165 Ga0070686_100067996
166 Ga0068859_100367510
167 Ga0070717_10035855
168 Ga0070712_100055603
169 Ga0070712_100059501
170 Ga0070712_100195182
171 Ga0075431_101098798
172 Ga0068865_100357308
173 Ga0097620_100367502
174 Ga0111539_10001432
175 Ga0105246_10307958
176 Ga0163162_10434228
177 Ga0163163_10134999
178 Ga0157380_10192237
179 Ga0157379_10237575
180 Ga0157379_10626416
181 Ga0213875_10001472
182 Ga0207692_10015023
183 Ga0207643_10202445
184 Ga0207684_10025783
185 Ga0207684_10116047
186 Ga0207693_10294219
187 Ga0207646_10057363
188 Ga0207659_10223803
189 Ga0207700_10125205
190 Ga0207664_10059903
191 Ga0207644_10029850
192 Ga0207669_10159411
193 Ga0207668_10249796
194 Ga0207658_10239272
195 Ga0207674_10432595
196 Ga0207428_10000071
197 Ga0268266_10695253
198 Ga0265316_10216133
199 Ga0307513_10278678
200 Ga0307408_100201056
201 Ga0307408_100212967
202 Ga0265314_10226757
203 Ga0316576_10113820
204 Ga0307405_10038074
205 Ga0307413_10047631
206 Ga0307410_10009734
207 Ga0307409_100066414
208 Ga0307409_100584032
209 Ga0307416_100098476
210 Ga0307414_10084839
211 Ga0307411_10175846
212 Ga0307415_100125673
213 Ga0307415_100332695
214 Ga0316583_10080487
215 Ga0373923_0196264
216 Ga0373953_0007684
217 Ga0373954_0008519
218 Ga0373956_0019763
219 Ga0373955_0087566
220 Ga0373924_0155692
221 Ga0373935_0069198
222 Ga0373933_0060466
223 Ga0373937_0013121
224 Ga0373937_0031661
225 Ga0316584_0020995
226 Ga0395898_0333063
227 Ga0436364_0305351
228 Ga0436364_0449559
229 Ga0436364_0465737
230 Ga0400483_030595
231 Ga0436365_0756618
232 Ga0436365_0873163
233 Ga0436365_1234939
234 Ga0436361_0007320
235 Ga0436361_0272285
236 Ga0436361_1143045
237 Ga0436361_1206550
238 Ga0436363_0427994
239 Ga0436362_0488310
240 Ga0436362_0740978
241 Ga0436362_0829540
242 Ga0466972_0205468
243 Ga0466965_0178790
244 Ga0451576_0013396
245 Ga0451576_0163306
246 Ga0495592_0100989
247 Ga0495651_0538937
248 Ga0495618_0039745
249 Ga0495640_0186964
250 Ga0495634_0084050
251 Ga0495635_0036039
252 Ga0495599_0037789
253 Ga0495684_0120312
254 Ga0501036_0263380
255 Ga0501038_0206040
256 Ga0501040_0093327
257 Ga0501041_0026123
258 Ga0501041_0157071
259 Ga0501042_0030918
260 Ga0501042_0500322
261 Ga0501042_0569220
262 Ga0501043_0561488
263 Ga0501046_0006249
264 Ga0501048_0059370
265 Ga0501068_0138465
266 Ga0501069_0083389
267 Ga0501071_0131798
268 Ga0501072_0005853
269 Ga0501074_0519762
270 Ga0501075_0122245
271 Ga0501075_0254206
272 Ga0501075_0672874
273 Ga0501076_0288564
274 Ga0501076_0462653
275 Ga0501076_0649217
276 Ga0501077_0078488
277 Ga0501252_000937
278 Ga0501079_0021001
279 Ga0501079_0156997
280 Ga0501080_0670235
281 Ga0501080_1002420
282 Ga0501081_0265692
283 Ga0501081_0390400
284 Ga0501045_0011017
285 Ga0501045_0115226
286 nmdc:mga06r32_916472_c1
287 nmdc:mga08y16_32_c1
288 nmdc:mga0a205_482706_c1
289 Ga0495601_0001859
290 Ga0495601_0209759
291 Ga0495595_0007951
292 Ga0495595_0047993
293 Ga0495619_0012096
294 Ga0495619_0043808
295 Ga0495619_0062834
296 Ga0501084_0074544
297 Ga0501084_0126989
298 Ga0530510_0212185
299 2508727069
300 2509074894
301 2774869643
302 2776262775
303 2834578626
304 2835318028
305 2882458412
306 2884301751
307 2894241285
308 2898796768
309 2899261068
310 2919679502
311 3000406969
312 8057135548

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

34

239

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9491 3 218
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.9396 3 218
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9364 3 218
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9272 3 218
1nsj-assembly1.cif.gz_A-2 crystal structure of phosphoribosyl anthranilate isomerase from thermotoga maritima 0.9252 3 218
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8968 3 218 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8877 3 218 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8858 4 214 3.20.20.70
4wuiA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8738 3 216 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8617 4 214 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A351T647-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9916 3 117 GO:0000162
GO:0004640
GO:0006568
AF-A0A0F9N9J8-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9852 1 83 GO:0000162
GO:0004640
GO:0006568
AF-A0A7C2W894-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9828 3 115 GO:0000162
GO:0004640
GO:0006568
AF-A0A257XIG7-F1-model_v4 deleted 0.9773 3 131
AF-A0A529K8N3-F1-model_v4 N-(5'-phosphoribosyl)anthranilate isomerase (EC 5.3.1.24) 0.9756 1 105 GO:0000162
GO:0004640
GO:0006568

Map