F224698

General Info

Members Datasets Scaffolds Average Seq Length
156 109 312 470

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10147574|Ga0111539_101475741
Length 504
Sequence LKCGIKNEELKMKKLIQINPRKLFLKSTFSFFILHSSFFIFSGCIAQKKTPTENISSVPIAFPGAEGFGKYTIGGRGGKIFIVSNLNDNGPGSFREAVEASGKRIVVFSVSGTIHLEKKLSIKGDITIAGQTAPGDGICIADQPVGLGGDNIIVRYLRFRMGDKFQRQMGMVDGSGGDDAFGGTRRKHIIIDHCSVSWSTDEVFSVYAGDSTTLQWNIISEPLNYSYHFETGDKDWEHHGYGGIWGGQHLSAHHNLFAHCVSRNPRFNGARLGATQELVDYRNNVIYNWGGNNVYGGEGGMYNLVNNYYRYGPSTSKNTRYRIVNPTRQEKPPIGFGKFFVEGNYVDEAPEVTKNNWLGIDMGNGGTEQEKKESVMAQAFVSVPIHAQTATDAYQSVLQQVGASLPVRDTLDARIITNVKNRTGGIIDVQGGFPHHTEFEKTINAWPNLKSLPAPTDSDKDGIPDSWERNNKLNPNDGTDATKLSLHSFYSNIEVYINSLTQSK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
96 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
97 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
100 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
101 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
102 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
103 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
104 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
105 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
106 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
107 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
108 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
109 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.36
Metatranscriptomes 0
Isolates 0.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.21
Nodule 0
Rhizoplane 0
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10147574 3300009094 Bacteria 2754
2 rootH1_10005571 3300003316 Bacteria 13082
3 rootL2_10012558 3300003322 Bacteria 4492
4 rootH1_10017193 3300003323 Bacteria 31677
5 rootH1_10073413 3300003323 Unclassified 3300
6 Ga0065714_10067659 3300005288 Bacteria 5302
7 Ga0065712_10068344 3300005290 Bacteria 11536
8 Ga0070683_100003744 3300005329 Bacteria 12409
9 Ga0070670_100033547 3300005331 Bacteria 4421
10 Ga0070670_100053234 3300005331 Bacteria 3475
11 Ga0068869_100030136 3300005334 Bacteria 3806
12 Ga0068869_100045260 3300005334 Bacteria 3167
13 Ga0068869_100161323 3300005334 Bacteria 1745
14 Ga0070666_10000696 3300005335 Bacteria 20362
15 Ga0070689_100027613 3300005340 Bacteria 4279
16 Ga0070675_100067604 3300005354 Bacteria 2957
17 Ga0070674_100005368 3300005356 Bacteria 7391
18 Ga0070688_100001577 3300005365 Bacteria 11378
19 Ga0070688_100014435 3300005365 Bacteria 4477
20 Ga0070667_100017925 3300005367 Bacteria 5869
21 Ga0070667_100019819 3300005367 Bacteria 5581
22 Ga0068867_100079596 3300005459 Bacteria 2466
23 Ga0070685_10001879 3300005466 Bacteria 10967
24 Ga0070698_100000935 3300005471 Bacteria 31956
25 Ga0070698_100007253 3300005471 Bacteria 12007
26 Ga0068853_100003299 3300005539 Bacteria 12346
27 Ga0070672_100187935 3300005543 Bacteria 1723
28 Ga0070686_100044311 3300005544 Bacteria 2795
29 Ga0068855_100008590 3300005563 Bacteria 12346
30 Ga0070664_100025266 3300005564 Bacteria 4922
31 Ga0068857_100030904 3300005577 Bacteria 4732
32 Ga0068857_100049547 3300005577 Bacteria 3726
33 Ga0068856_100198064 3300005614 Bacteria 2023
34 Ga0068864_100020914 3300005618 Bacteria 5478
35 Ga0068864_100053893 3300005618 Bacteria 3470
36 Ga0068861_100039488 3300005719 Bacteria 3523
37 Ga0068863_100001430 3300005841 Bacteria 23658
38 Ga0068863_100006981 3300005841 Bacteria 11073
39 Ga0068863_100191961 3300005841 Bacteria 1963
40 Ga0068860_100001534 3300005843 Bacteria 24870
41 Ga0068860_100115681 3300005843 Unclassified 2565
42 Ga0068862_100064842 3300005844 Unclassified 3145
43 Ga0068862_100162161 3300005844 Bacteria 1996
44 Ga0097621_100054418 3300006237 Bacteria 3264
45 Ga0075428_100028592 3300006844 Bacteria 6168
46 Ga0075430_100014338 3300006846 Bacteria 6755
47 Ga0075430_100077322 3300006846 Bacteria 2789
48 Ga0075431_100016952 3300006847 Bacteria 7398
49 Ga0075429_100041525 3300006880 Bacteria 4006
50 Ga0114129_10005171 3300009147 Bacteria 18363
51 Ga0114129_10054887 3300009147 Bacteria 5585
52 Ga0114129_10130099 3300009147 Bacteria 3458
53 Ga0105243_10154371 3300009148 Bacteria 1972
54 Ga0105241_10027869 3300009174 Bacteria 4207
55 Ga0105242_10003349 3300009176 Bacteria 12467
56 Ga0105242_10064749 3300009176 Bacteria 3014
57 Ga0105237_10004774 3300009545 Bacteria 15583
58 Ga0105237_10094449 3300009545 Unclassified 2980
59 Ga0105249_10001120 3300009553 Bacteria 23848
60 Ga0105249_10001277 3300009553 Bacteria 22079
61 Ga0105249_10010380 3300009553 Bacteria 8185
62 Ga0105239_10007195 3300010375 Bacteria 12794
63 Ga0105246_10089161 3300011119 Unclassified 2218
64 Ga0157373_10075688 3300013100 Bacteria 2375
65 Ga0157374_10064448 3300013296 Unclassified 3438
66 Ga0157374_10144135 3300013296 Bacteria 2313
67 Ga0157378_10003239 3300013297 Bacteria 14486
68 Ga0163162_10005445 3300013306 Bacteria 12300
69 Ga0157372_10103409 3300013307 Bacteria 3255
70 Ga0157372_10343996 3300013307 Bacteria 1737
71 Ga0157375_10120778 3300013308 Bacteria 2729
72 Ga0157380_10002783 3300014326 Bacteria 11884
73 Ga0157380_10213588 3300014326 Bacteria 1721
74 Ga0163161_10003685 3300017792 Bacteria 10747
75 Ga0207656_10015842 3300025321 Bacteria 2925
76 Ga0207680_10000120 3300025903 Bacteria 36545
77 Ga0207671_10001247 3300025914 Bacteria 29996
78 Ga0207662_10055297 3300025918 Bacteria 2368
79 Ga0207650_10009524 3300025925 Bacteria 6638
80 Ga0207650_10049084 3300025925 Bacteria 3115
81 Ga0207659_10010725 3300025926 Bacteria 5763
82 Ga0207686_10003751 3300025934 Bacteria 8153
83 Ga0207686_10184348 3300025934 Unclassified 1482
84 Ga0207670_10060419 3300025936 Bacteria 2582
85 Ga0207670_10144820 3300025936 Bacteria 1756
86 Ga0207669_10051948 3300025937 Unclassified 2459
87 Ga0207704_10029901 3300025938 Unclassified 3046
88 Ga0207691_10007108 3300025940 Bacteria 10807
89 Ga0207689_10034323 3300025942 Bacteria 4214
90 Ga0207689_10060902 3300025942 Bacteria 3104
91 Ga0207667_10034444 3300025949 Bacteria 5437
92 Ga0207651_10001621 3300025960 Bacteria 10325
93 Ga0207712_10002628 3300025961 Bacteria 11509
94 Ga0207712_10005627 3300025961 Bacteria 7905
95 Ga0207712_10007320 3300025961 Bacteria 6966
96 Ga0207658_10026497 3300025986 Unclassified 4064
97 Ga0207639_10006772 3300026041 Bacteria 7799
98 Ga0207639_10037104 3300026041 Bacteria 3618
99 Ga0207708_10101359 3300026075 Bacteria 2229
100 Ga0207702_10115012 3300026078 Bacteria 2398
101 Ga0207641_10001343 3300026088 Bacteria 24358
102 Ga0207641_10001908 3300026088 Bacteria 20026
103 Ga0207641_10071510 3300026088 Unclassified 2984
104 Ga0207641_10107173 3300026088 Bacteria 2471
105 Ga0207676_10015499 3300026095 Bacteria 5500
106 Ga0207676_10016316 3300026095 Bacteria 5378
107 Ga0207676_10059283 3300026095 Bacteria 3022
108 Ga0207674_10089598 3300026116 Bacteria 3069
109 Ga0207675_100099033 3300026118 Bacteria 2746
110 Ga0209999_1008164 3300027543 Bacteria 1884
111 Ga0268264_10002898 3300028381 Bacteria 14907
112 Ga0268264_10004865 3300028381 Bacteria 11381
113 Ga0307515_10048090 3300028794 Bacteria 6459
114 Ga0307513_10058028 3300031456 Bacteria 4118
115 Ga0307513_10126126 3300031456 Unclassified 2515
116 Ga0307516_10182201 3300031730 Bacteria 1833
117 Ga0307412_10062783 3300031911 Bacteria 2503
118 Ga0395905_0002019 3300037471 Bacteria 23194
119 Ga0395905_0090942 3300037471 Bacteria 2861
120 Ga0439431_0009671 3300041997 Bacteria 2179
121 Ga0439457_000541 3300042014 Bacteria 11021
122 Ga0451577_0000010 3300042876 Bacteria 616686
123 Ga0451577_0013387 3300042876 Bacteria 7679
124 Ga0466969_0008560 3300044656 Bacteria 5428
125 Ga0466972_0000007 3300044658 Bacteria 277010
126 Ga0453683_0000307 3300044673 Bacteria 61515
127 Ga0453683_0045403 3300044673 Bacteria 2755
128 Ga0453683_0062525 3300044673 Unclassified 2327
129 Ga0453684_0000130 3300044712 Bacteria 331761
130 Ga0466957_0000073 3300044842 Bacteria 39412
131 Ga0466959_0061319 3300045049 Bacteria 2734
132 Ga0451576_0000679 3300045051 Bacteria 69256
133 Ga0451576_0013802 3300045051 Bacteria 9024
134 Ga0451576_0117439 3300045051 Unclassified 2769
135 Ga0495668_0001235 3300046616 Bacteria 25682
136 Ga0495672_0003793 3300047320 Bacteria 12719
137 Ga0495672_0004090 3300047320 Bacteria 12166
138 Ga0501047_0026372 3300049581 Bacteria 5591
139 Ga0501198_000689 3300049649 Bacteria 4204
140 Ga0501202_012785 3300049652 Bacteria 1589
141 Ga0501243_003526 3300049675 Bacteria 2322
142 Ga0501044_0020959 3300049823 Bacteria 6979
143 nmdc:mga05p37_109478_c1 3300050507 Bacteria 3398
144 nmdc:mga05p37_278585_c1 3300050507 Bacteria 1995
145 nmdc:mga05p37_6736_c1 3300050507 Bacteria 13545
146 nmdc:mga09592_228086_c1 3300050508 Bacteria 1614
147 nmdc:mga0qj67_22189_c1 3300050509 Bacteria 4875
148 nmdc:mga06r32_22279_c1 3300050510 Bacteria 5855
149 nmdc:mga08y16_387029_c1 3300050511 Bacteria 1433
150 Ga0500578_0021736 3300053086 Bacteria 4121
151 Ga0500583_0000028 3300053092 Bacteria 108276
152 Ga0500583_0002361 3300053092 Bacteria 5653
153 Ga0500616_0004958 3300053153 Bacteria 9236
154 Ga0500611_000070 3300053727 Bacteria 41745
155 Ga0466962_0071023 3300061719 Bacteria 1664
156 2738724299 2738541278 Bacteria 9755573
157 Ga0111539_10147574
158 rootH1_10005571
159 rootL2_10012558
160 rootH1_10017193
161 rootH1_10073413
162 Ga0065714_10067659
163 Ga0065712_10068344
164 Ga0070683_100003744
165 Ga0070670_100033547
166 Ga0070670_100053234
167 Ga0068869_100030136
168 Ga0068869_100045260
169 Ga0068869_100161323
170 Ga0070666_10000696
171 Ga0070689_100027613
172 Ga0070675_100067604
173 Ga0070674_100005368
174 Ga0070688_100001577
175 Ga0070688_100014435
176 Ga0070667_100017925
177 Ga0070667_100019819
178 Ga0068867_100079596
179 Ga0070685_10001879
180 Ga0070698_100000935
181 Ga0070698_100007253
182 Ga0068853_100003299
183 Ga0070672_100187935
184 Ga0070686_100044311
185 Ga0068855_100008590
186 Ga0070664_100025266
187 Ga0068857_100030904
188 Ga0068857_100049547
189 Ga0068856_100198064
190 Ga0068864_100020914
191 Ga0068864_100053893
192 Ga0068861_100039488
193 Ga0068863_100001430
194 Ga0068863_100006981
195 Ga0068863_100191961
196 Ga0068860_100001534
197 Ga0068860_100115681
198 Ga0068862_100064842
199 Ga0068862_100162161
200 Ga0097621_100054418
201 Ga0075428_100028592
202 Ga0075430_100014338
203 Ga0075430_100077322
204 Ga0075431_100016952
205 Ga0075429_100041525
206 Ga0114129_10005171
207 Ga0114129_10054887
208 Ga0114129_10130099
209 Ga0105243_10154371
210 Ga0105241_10027869
211 Ga0105242_10003349
212 Ga0105242_10064749
213 Ga0105237_10004774
214 Ga0105237_10094449
215 Ga0105249_10001120
216 Ga0105249_10001277
217 Ga0105249_10010380
218 Ga0105239_10007195
219 Ga0105246_10089161
220 Ga0157373_10075688
221 Ga0157374_10064448
222 Ga0157374_10144135
223 Ga0157378_10003239
224 Ga0163162_10005445
225 Ga0157372_10103409
226 Ga0157372_10343996
227 Ga0157375_10120778
228 Ga0157380_10002783
229 Ga0157380_10213588
230 Ga0163161_10003685
231 Ga0207656_10015842
232 Ga0207680_10000120
233 Ga0207671_10001247
234 Ga0207662_10055297
235 Ga0207650_10009524
236 Ga0207650_10049084
237 Ga0207659_10010725
238 Ga0207686_10003751
239 Ga0207686_10184348
240 Ga0207670_10060419
241 Ga0207670_10144820
242 Ga0207669_10051948
243 Ga0207704_10029901
244 Ga0207691_10007108
245 Ga0207689_10034323
246 Ga0207689_10060902
247 Ga0207667_10034444
248 Ga0207651_10001621
249 Ga0207712_10002628
250 Ga0207712_10005627
251 Ga0207712_10007320
252 Ga0207658_10026497
253 Ga0207639_10006772
254 Ga0207639_10037104
255 Ga0207708_10101359
256 Ga0207702_10115012
257 Ga0207641_10001343
258 Ga0207641_10001908
259 Ga0207641_10071510
260 Ga0207641_10107173
261 Ga0207676_10015499
262 Ga0207676_10016316
263 Ga0207676_10059283
264 Ga0207674_10089598
265 Ga0207675_100099033
266 Ga0209999_1008164
267 Ga0268264_10002898
268 Ga0268264_10004865
269 Ga0307515_10048090
270 Ga0307513_10058028
271 Ga0307513_10126126
272 Ga0307516_10182201
273 Ga0307412_10062783
274 Ga0395905_0002019
275 Ga0395905_0090942
276 Ga0439431_0009671
277 Ga0439457_000541
278 Ga0451577_0000010
279 Ga0451577_0013387
280 Ga0466969_0008560
281 Ga0466972_0000007
282 Ga0453683_0000307
283 Ga0453683_0045403
284 Ga0453683_0062525
285 Ga0453684_0000130
286 Ga0466957_0000073
287 Ga0466959_0061319
288 Ga0451576_0000679
289 Ga0451576_0013802
290 Ga0451576_0117439
291 Ga0495668_0001235
292 Ga0495672_0003793
293 Ga0495672_0004090
294 Ga0501047_0026372
295 Ga0501198_000689
296 Ga0501202_012785
297 Ga0501243_003526
298 Ga0501044_0020959
299 nmdc:mga05p37_109478_c1
300 nmdc:mga05p37_278585_c1
301 nmdc:mga05p37_6736_c1
302 nmdc:mga09592_228086_c1
303 nmdc:mga0qj67_22189_c1
304 nmdc:mga06r32_22279_c1
305 nmdc:mga08y16_387029_c1
306 Ga0500578_0021736
307 Ga0500583_0000028
308 Ga0500583_0002361
309 Ga0500616_0004958
310 Ga0500611_000070
311 Ga0466962_0071023
312 2738724299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xks-assembly1.cif.gz_A crystal structure of an alkaline pectate lyase from bacillus clausii 0.7293 32 364
7bbv-assembly2.cif.gz_B pectate lyase b from verticillium dahliae 0.7248 32 367
7xks-assembly1.cif.gz_A crystal structure of an alkaline pectate lyase from bacillus clausii 0.7052 32 364
7bbv-assembly2.cif.gz_B pectate lyase b from verticillium dahliae 0.7006 32 367
6fi2-assembly1.cif.gz_A vexl: a periplasmic depolymerase provides new insight into abc transporter-dependent secretion of bacterial capsular polysaccharides 0.6904 32 269
ID Description Score Start End Superfamily
af_A0A1D6LSL8_83_290_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.8351 31 179 2.160.20.10
af_A0A0R0ERP7_9_313_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7253 30 323 2.160.20.10
af_A0A1D6N7M8_24_253_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7073 30 258 2.160.20.10
af_A0A0R0HUQ2_38_368_2.160.20.10 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7021 32 294 2.160.20.10
1pxzA00 Mainly Beta;3 Solenoid;Pectate Lyase C-like;Single-stranded right-handed beta-helix, Pectin lyase-like 0.7019 31 364 2.160.20.10
ID Description Score Start End GO Terms
AF-A0A350UFS2-F1-model_v4 Pectate lyase 0.9801 23 83 GO:0016829
AF-A0A1V5RI94-F1-model_v4 Ferrous iron transport protein B 0.9789 23 181 GO:0005525
GO:0005886
GO:0015093
AF-K1U4L8-F1-model_v4 Pectate lyase 0.9768 25 118
AF-A0A356WYL6-F1-model_v4 Pectate lyase 0.9761 23 110 GO:0016829
AF-A0A537KGS6-F1-model_v4 Pectate lyase 0.9755 25 464 GO:0016829

Map