F223649

General Info

Members Datasets Scaffolds Average Seq Length
156 112 144 252

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10027099|JGI24740J21852_100270992
Length 265
Sequence MKILIIEDEPLVAVSLVNLVKELEPSANIDGPVGSVREAGEWFNNHAQPDLILSDIQLSDGISLDLFSGNNPSCPVIFTTAYDEYAIRAFKVNSIDYLLKPIEKAELQNAFQKFYLMQSKFTNEVYLHQMKELFSNFRQSRQYKERFAVHIGRSVTMIPIEEIALFIKEELIFLINREGQKFITDYRSLDEVEELLNPRIFYRVNRQHLVHLPFIESYRGDDTGKITLKVRGIKTAAPMIVKTRLLIFENGLMSDNSLFSFHTFS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
3 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
4 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
5 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
6 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
7 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
8 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
9 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
10 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
11 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
39 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
40 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
60 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
75 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
84 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
85 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
90 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
91 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
105 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
106 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
109 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
110 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
111 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
112 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.31
Metatranscriptomes 0
Isolates 7.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.92
Nodule 3.85
Rhizoplane 0
Rhizosphere 85.26
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2838224 2162886007 Bacteria 1745
2 JGI24740J21852_10027099 3300001979 Bacteria 1911
3 rootH1_10180679 3300003316 Bacteria 1489
4 rootH2_10341539 3300003320 Unclassified 1050
5 rootL2_10001169 3300003322 Bacteria 6421
6 rootL2_10217713 3300003322 Bacteria 1567
7 rootL2_10321528 3300003322 Bacteria 1464
8 Ga0065704_10083760 3300005289 Bacteria 3423
9 Ga0065704_10188193 3300005289 Bacteria 1202
10 Ga0070676_10023677 3300005328 Bacteria 3452
11 Ga0070683_100027112 3300005329 Bacteria 5164
12 Ga0070670_100231502 3300005331 Bacteria 1608
13 Ga0068869_100046764 3300005334 Bacteria 3121
14 Ga0070675_100607464 3300005354 Bacteria 992
15 Ga0068867_100015593 3300005459 Bacteria 5392
16 Ga0070684_100084513 3300005535 Bacteria 2814
17 Ga0068853_100109014 3300005539 Bacteria 2457
18 Ga0070704_100483874 3300005549 Unclassified 1071
19 Ga0068855_100074658 3300005563 Bacteria 3938
20 Ga0068857_100137101 3300005577 Bacteria 2210
21 Ga0068856_100112907 3300005614 Bacteria 2715
22 Ga0068859_100015029 3300005617 Bacteria 7771
23 Ga0068864_100178607 3300005618 Bacteria 1939
24 Ga0068864_100373333 3300005618 Bacteria 1350
25 Ga0068851_10000148 3300005834 Bacteria 37601
26 Ga0068851_10190410 3300005834 Bacteria 1140
27 Ga0068863_100268708 3300005841 Bacteria 1650
28 Ga0068863_100687680 3300005841 Unclassified 1016
29 Ga0068860_100060008 3300005843 Bacteria 3615
30 Ga0068862_100023844 3300005844 Bacteria 5129
31 Ga0068862_100261064 3300005844 Bacteria 1581
32 Ga0097621_100806224 3300006237 Bacteria 870
33 Ga0068871_100316424 3300006358 Unclassified 1373
34 Ga0097620_100015029 3300006931 Bacteria 7771
35 Ga0099824_1008105 3300006942 Bacteria 13560
36 Ga0079104_1000005 3300006946 Bacteria 407099
37 Ga0099826_10077209 3300006948 Bacteria 2090
38 Ga0105251_10092531 3300009011 Bacteria 1388
39 Ga0105240_10491351 3300009093 Bacteria 1366
40 Ga0105240_10650071 3300009093 Unclassified 1156
41 Ga0111539_10088226 3300009094 Bacteria 3644
42 Ga0111539_10500701 3300009094 Bacteria 1415
43 Ga0105245_10077084 3300009098 Bacteria 3038
44 Ga0114129_10003677 3300009147 Bacteria 21578
45 Ga0105241_10005943 3300009174 Bacteria 8998
46 Ga0105241_10150625 3300009174 Bacteria 1903
47 Ga0105237_10038332 3300009545 Bacteria 4840
48 Ga0105237_10070966 3300009545 Bacteria 3478
49 Ga0105249_10304382 3300009553 Bacteria 1600
50 Ga0105249_10452864 3300009553 Bacteria 1322
51 Ga0105239_10007924 3300010375 Bacteria 12143
52 Ga0105239_10050770 3300010375 Bacteria 4548
53 Ga0157373_10000002 3300013100 Bacteria 750094
54 Ga0157371_10009948 3300013102 Bacteria 7443
55 Ga0157371_10168702 3300013102 Bacteria 1563
56 Ga0157370_10000097 3300013104 Bacteria 99144
57 Ga0157370_10029307 3300013104 Bacteria 5404
58 Ga0157378_10035115 3300013297 Unclassified 4433
59 Ga0163162_10543854 3300013306 Unclassified 1290
60 Ga0157372_10012596 3300013307 Bacteria 9005
61 Ga0157372_10023390 3300013307 Bacteria 6697
62 Ga0157372_10134795 3300013307 Bacteria 2843
63 Ga0157372_10198966 3300013307 Bacteria 2321
64 Ga0163163_10034213 3300014325 Bacteria 4919
65 Ga0163163_10393595 3300014325 Unclassified 1444
66 Ga0157380_10000525 3300014326 Bacteria 23544
67 Ga0157380_10034673 3300014326 Bacteria 3893
68 Ga0157377_10300864 3300014745 Bacteria 1059
69 Ga0182006_1004705 3300015261 Bacteria 6677
70 Ga0182006_1051197 3300015261 Bacteria 1589
71 Ga0182006_1055455 3300015261 Bacteria 1513
72 Ga0207656_10000145 3300025321 Bacteria 26743
73 Ga0207645_10131613 3300025907 Bacteria 1628
74 Ga0207654_10015930 3300025911 Bacteria 3909
75 Ga0207695_10458317 3300025913 Bacteria 1158
76 Ga0207695_10500019 3300025913 Unclassified 1098
77 Ga0207671_10094852 3300025914 Bacteria 2252
78 Ga0207689_10525845 3300025942 Unclassified 992
79 Ga0207661_10098607 3300025944 Bacteria 2449
80 Ga0207679_10353087 3300025945 Unclassified 1282
81 Ga0207667_10011086 3300025949 Bacteria 10496
82 Ga0207712_10267740 3300025961 Bacteria 1388
83 Ga0207648_10087612 3300026089 Bacteria 2717
84 Ga0207676_10351742 3300026095 Bacteria 1363
85 Ga0207676_10496304 3300026095 Bacteria 1158
86 Ga0207674_10091014 3300026116 Bacteria 3041
87 Ga0209281_1000216 3300027111 Bacteria 125724
88 Ga0209489_115009 3300027361 Bacteria 5032
89 Ga0209282_1066461 3300027666 Bacteria 1985
90 Ga0268265_10030268 3300028380 Bacteria 3896
91 Ga0268264_10101590 3300028381 Bacteria 2500
92 Ga0265334_10043421 3300028573 Unclassified 1749
93 Ga0265322_10031232 3300028654 Bacteria 1520
94 Ga0265336_10010401 3300028666 Bacteria 3185
95 Ga0265338_10306104 3300028800 Bacteria 1154
96 Ga0265327_10000400 3300031251 Bacteria 81145
97 Ga0307513_10240830 3300031456 Bacteria 1614
98 Ga0307509_10012242 3300031507 Bacteria 10288
99 Ga0307508_10001286 3300031616 Bacteria 28488
100 Ga0307508_10186015 3300031616 Bacteria 1679
101 Ga0307416_100023124 3300032002 Bacteria 4504
102 Ga0307414_10033369 3300032004 Unclassified 3402
103 Ga0439431_0013659 3300041997 Unclassified 1875
104 Ga0439457_034056 3300042014 Unclassified 1131
105 Ga0439434_0045439 3300042435 Unclassified 1354
106 Ga0451577_0000103 3300042876 Bacteria 186594
107 Ga0451577_0000417 3300042876 Bacteria 77265
108 Ga0451577_0030861 3300042876 Bacteria 4840
109 Ga0451577_0031492 3300042876 Bacteria 4784
110 Ga0451577_0463409 3300042876 Bacteria 1151
111 Ga0466969_0000339 3300044656 Bacteria 26000
112 Ga0453683_0021934 3300044673 Bacteria 4074
113 Ga0466966_0000866 3300044684 Bacteria 19336
114 Ga0466961_0070366 3300044693 Bacteria 2221
115 Ga0466964_0019527 3300044706 Bacteria 2605
116 Ga0453684_0000469 3300044712 Bacteria 160413
117 Ga0453684_0001151 3300044712 Bacteria 82556
118 Ga0453684_0001245 3300044712 Bacteria 77266
119 Ga0453684_0010675 3300044712 Bacteria 15623
120 Ga0453684_0157258 3300044712 Bacteria 2693
121 Ga0453684_0162362 3300044712 Bacteria 2641
122 Ga0453684_0199209 3300044712 Bacteria 2335
123 Ga0453684_0254209 3300044712 Bacteria 2016
124 Ga0466968_0018727 3300044735 Bacteria 2779
125 Ga0466957_0000085 3300044842 Bacteria 37682
126 Ga0466959_0000053 3300045049 Bacteria 81055
127 Ga0451576_0000297 3300045051 Bacteria 120836
128 Ga0451576_0000585 3300045051 Bacteria 77207
129 Ga0451576_0002388 3300045051 Bacteria 28233
130 Ga0451576_0003537 3300045051 Bacteria 21306
131 Ga0451576_0005321 3300045051 Bacteria 16182
132 Ga0451576_0056012 3300045051 Bacteria 4124
133 Ga0495686_0002169 3300047472 Bacteria 19126
134 Ga0495686_0060254 3300047472 Bacteria 2360
135 Ga0496121_0146093 3300048924 Bacteria 1747
136 Ga0501300_001722 3300049523 Bacteria 3279
137 Ga0501217_009189 3300049661 Bacteria 2145
138 Ga0501247_002052 3300049677 Bacteria 2055
139 nmdc:mga05p37_13302_c1 3300050507 Bacteria 9855
140 nmdc:mga08y16_299004_c1 3300050511 Bacteria 1659
141 nmdc:mga08y16_426253_c1 3300050511 Bacteria 1355
142 Ga0500616_0020081 3300053153 Bacteria 3756
143 Ga0500622_0000004 3300053156 Bacteria 557587
144 Ga0500622_0000005 3300053156 Bacteria 502443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10341539 rootH2_103415392 224
2 3300028666 Ga0265336_10010401 Ga0265336_100104012 225
3 3300028800 Ga0265338_10306104 Ga0265338_103061041 225
4 3300031251 Ga0265327_10000400 Ga0265327_1000040012 229
5 3300003322 rootL2_10001169 rootL2_100011695 230
6 3300044712 Ga0453684_0010675 Ga0453684_0010675_4550_5305 239
7 3300006946 Ga0079104_1000005 Ga0079104_1000005271 242
8 3300027111 Ga0209281_1000216 Ga0209281_100021658 242
9 3300003322 rootL2_10217713 rootL2_102177132 243
10 3300044712 Ga0453684_0199209 Ga0453684_0199209_1291_2034 244
11 3300045051 Ga0451576_0056012 Ga0451576_0056012_2746_3489 244
12 3300003322 rootL2_10321528 rootL2_103215282 245
13 iso_pu_bacteria 2519899754 2520879021 245
14 iso_pu_bacteria 2643221725 2644685078 245
15 iso_pu_bacteria 2802428842 2802654001 245
16 iso_pu_bacteria 2816332280 2817415999 245
17 iso_pu_bacteria 2881359912 2881361923 245
18 iso_pu_bacteria 2903895155 2903897236 245
19 iso_pu_bacteria 2958458903 2958461480 245
20 iso_pu_bacteria 2977268062 2977269889 245
21 iso_pu_bacteria 8055419101 8055421722 245
22 iso_pu_bacteria 8055592153 8055593848 245
23 3300044712 Ga0453684_0254209 Ga0453684_0254209_314_1072 247
24 3300045051 Ga0451576_0002388 Ga0451576_0002388_7718_8476 247
25 3300045051 Ga0451576_0005321 Ga0451576_0005321_2794_3552 247
26 iso_pu_bacteria 2883068021 2883068554 247
27 3300048924 Ga0496121_0146093 Ga0496121_0146093_724_1476 248
28 3300003316 rootH1_10180679 rootH1_101806792 249
29 3300006942 Ga0099824_1008105 Ga0099824_100810515 249
30 3300006948 Ga0099826_10077209 Ga0099826_100772092 249
31 3300009011 Ga0105251_10092531 Ga0105251_100925312 249
32 3300013100 Ga0157373_10000002 Ga0157373_10000002218 249
33 3300013102 Ga0157371_10168702 Ga0157371_101687022 249
34 3300013104 Ga0157370_10000097 Ga0157370_1000009721 249
35 3300015261 Ga0182006_1004705 Ga0182006_10047052 249
36 3300015261 Ga0182006_1051197 Ga0182006_10511972 249
37 3300015261 Ga0182006_1055455 Ga0182006_10554552 249
38 3300027361 Ga0209489_115009 Ga0209489_1150094 249
39 3300027666 Ga0209282_1066461 Ga0209282_10664612 249
40 3300032002 Ga0307416_100023124 Ga0307416_1000231243 249
41 iso_pu_bacteria 2896109856 2896110983 250
42 3300006358 Ga0068871_100316424 Ga0068871_1003164242 251
43 3300009098 Ga0105245_10077084 Ga0105245_100770843 251
44 3300013102 Ga0157371_10009948 Ga0157371_100099482 251
45 3300013307 Ga0157372_10012596 Ga0157372_100125965 251
46 3300013307 Ga0157372_10198966 Ga0157372_101989662 251
47 3300042876 Ga0451577_0000103 Ga0451577_0000103_109789_110550 251
48 3300028573 Ga0265334_10043421 Ga0265334_100434212 252
49 3300028654 Ga0265322_10031232 Ga0265322_100312322 252
50 3300031456 Ga0307513_10240830 Ga0307513_102408302 252
51 3300042876 Ga0451577_0000417 Ga0451577_0000417_65716_66486 252
52 3300042876 Ga0451577_0030861 Ga0451577_0030861_2775_3542 252
53 3300042876 Ga0451577_0031492 Ga0451577_0031492_3792_4559 252
54 3300042876 Ga0451577_0463409 Ga0451577_0463409_224_991 252
55 3300044673 Ga0453683_0021934 Ga0453683_0021934_541_1308 252
56 3300044712 Ga0453684_0000469 Ga0453684_0000469_102146_102913 252
57 3300044712 Ga0453684_0001151 Ga0453684_0001151_70707_71474 252
58 3300044712 Ga0453684_0001245 Ga0453684_0001245_65716_66486 252
59 3300044712 Ga0453684_0157258 Ga0453684_0157258_71_841 252
60 3300044712 Ga0453684_0162362 Ga0453684_0162362_119_883 252
61 3300045051 Ga0451576_0000297 Ga0451576_0000297_27319_28086 252
62 3300045051 Ga0451576_0000585 Ga0451576_0000585_10781_11551 252
63 3300045051 Ga0451576_0003537 Ga0451576_0003537_20091_20858 252
64 3300049523 Ga0501300_001722 Ga0501300_001722_1041_1826 252
65 3300049661 Ga0501217_009189 Ga0501217_009189_568_1353 252
66 3300049677 Ga0501247_002052 Ga0501247_002052_331_1116 252
67 3300005328 Ga0070676_10023677 Ga0070676_100236771 253
68 3300005329 Ga0070683_100027112 Ga0070683_1000271127 253
69 3300005334 Ga0068869_100046764 Ga0068869_1000467643 253
70 3300005354 Ga0070675_100607464 Ga0070675_1006074641 253
71 3300005459 Ga0068867_100015593 Ga0068867_1000155932 253
72 3300005535 Ga0070684_100084513 Ga0070684_1000845132 253
73 3300005549 Ga0070704_100483874 Ga0070704_1004838742 253
74 3300005617 Ga0068859_100015029 Ga0068859_1000150296 253
75 3300005618 Ga0068864_100178607 Ga0068864_1001786072 253
76 3300005618 Ga0068864_100373333 Ga0068864_1003733332 253
77 3300005834 Ga0068851_10190410 Ga0068851_101904102 253
78 3300005841 Ga0068863_100687680 Ga0068863_1006876802 253
79 3300005843 Ga0068860_100060008 Ga0068860_1000600082 253
80 3300005844 Ga0068862_100023844 Ga0068862_1000238442 253
81 3300006237 Ga0097621_100806224 Ga0097621_1008062241 253
82 3300006931 Ga0097620_100015029 Ga0097620_1000150294 253
83 3300009093 Ga0105240_10491351 Ga0105240_104913512 253
84 3300013104 Ga0157370_10029307 Ga0157370_100293074 253
85 3300013297 Ga0157378_10035115 Ga0157378_100351156 253
86 3300013306 Ga0163162_10543854 Ga0163162_105438542 253
87 3300013307 Ga0157372_10023390 Ga0157372_100233907 253
88 3300014325 Ga0163163_10034213 Ga0163163_100342132 253
89 3300014325 Ga0163163_10393595 Ga0163163_103935952 253
90 3300014326 Ga0157380_10000525 Ga0157380_1000052513 253
91 3300014326 Ga0157380_10034673 Ga0157380_100346732 253
92 3300025907 Ga0207645_10131613 Ga0207645_101316132 253
93 3300025913 Ga0207695_10458317 Ga0207695_104583172 253
94 3300025942 Ga0207689_10525845 Ga0207689_105258452 253
95 3300025944 Ga0207661_10098607 Ga0207661_100986072 253
96 3300025945 Ga0207679_10353087 Ga0207679_103530871 253
97 3300026089 Ga0207648_10087612 Ga0207648_100876122 253
98 3300026095 Ga0207676_10351742 Ga0207676_103517421 253
99 3300026095 Ga0207676_10496304 Ga0207676_104963041 253
100 3300028380 Ga0268265_10030268 Ga0268265_100302682 253
101 3300028381 Ga0268264_10101590 Ga0268264_101015902 253
102 3300032004 Ga0307414_10033369 Ga0307414_100333692 253
103 3300041997 Ga0439431_0013659 Ga0439431_0013659_257_1018 253
104 3300042014 Ga0439457_034056 Ga0439457_034056_96_857 253
105 3300042435 Ga0439434_0045439 Ga0439434_0045439_475_1236 253
106 2162886007 SwRhRL2b_contig_2838224 SwRhRL2b_0473.00005970 254
107 3300001979 JGI24740J21852_10027099 JGI24740J21852_100270992 254
108 3300005289 Ga0065704_10083760 Ga0065704_100837602 254
109 3300005289 Ga0065704_10188193 Ga0065704_101881932 254
110 3300005331 Ga0070670_100231502 Ga0070670_1002315021 254
111 3300005539 Ga0068853_100109014 Ga0068853_1001090143 254
112 3300005563 Ga0068855_100074658 Ga0068855_1000746585 254
113 3300005577 Ga0068857_100137101 Ga0068857_1001371012 254
114 3300005614 Ga0068856_100112907 Ga0068856_1001129074 254
115 3300005834 Ga0068851_10000148 Ga0068851_1000014814 254
116 3300005841 Ga0068863_100268708 Ga0068863_1002687082 254
117 3300005844 Ga0068862_100261064 Ga0068862_1002610642 254
118 3300009093 Ga0105240_10650071 Ga0105240_106500712 254
119 3300009094 Ga0111539_10088226 Ga0111539_100882261 254
120 3300009094 Ga0111539_10500701 Ga0111539_105007012 254
121 3300009147 Ga0114129_10003677 Ga0114129_1000367718 254
122 3300009174 Ga0105241_10005943 Ga0105241_100059438 254
123 3300009174 Ga0105241_10150625 Ga0105241_101506252 254
124 3300009545 Ga0105237_10038332 Ga0105237_100383323 254
125 3300009545 Ga0105237_10070966 Ga0105237_100709664 254
126 3300009553 Ga0105249_10304382 Ga0105249_103043822 254
127 3300009553 Ga0105249_10452864 Ga0105249_104528642 254
128 3300010375 Ga0105239_10007924 Ga0105239_100079243 254
129 3300010375 Ga0105239_10050770 Ga0105239_100507705 254
130 3300013307 Ga0157372_10134795 Ga0157372_101347952 254
131 3300014745 Ga0157377_10300864 Ga0157377_103008642 254
132 3300025321 Ga0207656_10000145 Ga0207656_1000014515 254
133 3300025911 Ga0207654_10015930 Ga0207654_100159305 254
134 3300025913 Ga0207695_10500019 Ga0207695_105000191 254
135 3300025914 Ga0207671_10094852 Ga0207671_100948521 254
136 3300025949 Ga0207667_10011086 Ga0207667_100110868 254
137 3300025961 Ga0207712_10267740 Ga0207712_102677401 254
138 3300026116 Ga0207674_10091014 Ga0207674_100910145 254
139 3300031507 Ga0307509_10012242 Ga0307509_100122425 254
140 3300031616 Ga0307508_10001286 Ga0307508_100012867 254
141 3300031616 Ga0307508_10186015 Ga0307508_101860152 254
142 3300044656 Ga0466969_0000339 Ga0466969_0000339_10607_11371 254
143 3300044684 Ga0466966_0000866 Ga0466966_0000866_1127_1891 254
144 3300044693 Ga0466961_0070366 Ga0466961_0070366_575_1339 254
145 3300044706 Ga0466964_0019527 Ga0466964_0019527_1458_2222 254
146 3300044735 Ga0466968_0018727 Ga0466968_0018727_1450_2214 254
147 3300044842 Ga0466957_0000085 Ga0466957_0000085_27175_27939 254
148 3300045049 Ga0466959_0000053 Ga0466959_0000053_32626_33390 254
149 3300047472 Ga0495686_0002169 Ga0495686_0002169_10153_10917 254
150 3300047472 Ga0495686_0060254 Ga0495686_0060254_1106_1870 254
151 3300050507 nmdc:mga05p37_13302_c1 nmdc:mga05p37_13302_c1_5920_6684 254
152 3300050511 nmdc:mga08y16_299004_c1 nmdc:mga08y16_299004_c1_88_858 254
153 3300050511 nmdc:mga08y16_426253_c1 nmdc:mga08y16_426253_c1_179_949 254
154 3300053153 Ga0500616_0020081 Ga0500616_0020081_1498_2262 254
155 3300053156 Ga0500622_0000004 Ga0500622_0000004_383368_384132 254
156 3300053156 Ga0500622_0000005 Ga0500622_0000005_322924_323688 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04397

LytTR

LytTr DNA-binding domain

153

241

0.9

PF00072

Response_reg

Response regulator receiver domain

3

112

0.88

Feature Viewer

pLDDT pTM Quality
82.24 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map