F222844

General Info

Members Datasets Scaffolds Average Seq Length
155 112 154 137

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_4084812|Ga0451853_4084812_206_691
Length 161
Sequence MTTESPIAAGADPGGTTSSEGQTRVALVEVVDAPLDLAAHEAAVADRRAGAVVSFQGVVRDHDHGRGVTLLEYEGHPSAAKVLREVAEEIAADPAVHAVAVSHRIGTLRIGDVALVASVSTAHRAAAFEACARLVDEAKARLPIWKRQVFTDGEEEWVNCP

Samples

Sample ID Description Type Environment
1 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
18 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
71 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
72 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
83 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
84 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
85 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
86 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
93 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
112 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.71
Metatranscriptomes 0.65
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.65
Nodule 0
Rhizoplane 7.1
Rhizosphere 81.29
Stem 0
Stem Tuber 0
Unclassified 10.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10071240 3300002067 Bacteria 996
2 JGI25406J46586_10049969 3300003203 Bacteria 1407
3 JGI25406J46586_10059808 3300003203 Bacteria 1235
4 Ga0070683_100681475 3300005329 Bacteria 984
5 Ga0070680_100867852 3300005336 Bacteria 778
6 Ga0070682_100019349 3300005337 Bacteria 3994
7 Ga0068868_100181153 3300005338 Bacteria 1748
8 Ga0068868_100606799 3300005338 Bacteria 970
9 Ga0070668_100001464 3300005347 Bacteria 17063
10 Ga0070668_101023245 3300005347 Bacteria 743
11 Ga0070675_100246524 3300005354 Bacteria 1562
12 Ga0070671_101563913 3300005355 Bacteria 584
13 Ga0070659_100181973 3300005366 Bacteria 1725
14 Ga0070667_100118613 3300005367 Bacteria 2300
15 Ga0070714_100697861 3300005435 Bacteria 979
16 Ga0070663_100092727 3300005455 Bacteria 2240
17 Ga0070695_100487603 3300005545 Bacteria 951
18 Ga0070665_100073420 3300005548 Bacteria 3427
19 Ga0070665_100160242 3300005548 Bacteria 2252
20 Ga0070665_101946882 3300005548 Bacteria 593
21 Ga0068854_100251921 3300005578 Bacteria 1410
22 Ga0070702_100184372 3300005615 Bacteria 1368
23 Ga0068852_100226880 3300005616 Bacteria 1779
24 Ga0068864_100045376 3300005618 Bacteria 3770
25 Ga0068863_100293717 3300005841 Bacteria 1575
26 Ga0068858_100878449 3300005842 Bacteria 876
27 Ga0068858_101066586 3300005842 Bacteria 793
28 Ga0068862_100263345 3300005844 Bacteria 1574
29 Ga0081455_10410399 3300005937 Bacteria 937
30 Ga0081455_10559590 3300005937 Bacteria 754
31 Ga0081539_10002231 3300005985 Bacteria 28236
32 Ga0081539_10003194 3300005985 Bacteria 20724
33 Ga0081539_10032254 3300005985 Bacteria 3211
34 Ga0070717_10819857 3300006028 Bacteria 846
35 Ga0068871_101714371 3300006358 Bacteria 596
36 Ga0075428_100216587 3300006844 Bacteria 2068
37 Ga0075428_100444259 3300006844 Bacteria 1389
38 Ga0075430_100560801 3300006846 Bacteria 942
39 Ga0075431_100172819 3300006847 Bacteria 2220
40 Ga0075431_100955241 3300006847 Bacteria 825
41 Ga0105240_11202336 3300009093 Bacteria 803
42 Ga0105245_10165619 3300009098 Bacteria 2101
43 Ga0105247_10576367 3300009101 Bacteria 831
44 Ga0105248_10170273 3300009177 Bacteria 2454
45 Ga0105238_10135299 3300009551 Bacteria 2442
46 Ga0105249_10360971 3300009553 Bacteria 1474
47 Ga0105246_10318042 3300011119 Bacteria 1263
48 Ga0157375_11249047 3300013308 Bacteria 872
49 Ga0157375_12372129 3300013308 Bacteria 633
50 Ga0157375_12517795 3300013308 Bacteria 614
51 Ga0163163_10203027 3300014325 Bacteria 2031
52 Ga0163163_10497382 3300014325 Bacteria 1281
53 Ga0157377_11029798 3300014745 Bacteria 626
54 Ga0157379_10339700 3300014968 Bacteria 1373
55 Ga0157379_10755046 3300014968 Bacteria 916
56 Ga0157376_10707326 3300014969 Bacteria 1013
57 Ga0157376_11405867 3300014969 Bacteria 729
58 Ga0224712_10091882 3300022467 Bacteria 1273
59 Ga0207688_10077389 3300025901 Bacteria 1896
60 Ga0207705_10240223 3300025909 Bacteria 1380
61 Ga0207660_11365416 3300025917 Bacteria 575
62 Ga0207659_10465311 3300025926 Bacteria 1067
63 Ga0207687_10196060 3300025927 Bacteria 1575
64 Ga0207644_11766154 3300025931 Bacteria 518
65 Ga0207709_11340252 3300025935 Bacteria 592
66 Ga0207711_10119762 3300025941 Bacteria 2349
67 Ga0207661_10599270 3300025944 Bacteria 1011
68 Ga0207661_11083449 3300025944 Bacteria 738
69 Ga0207661_11400198 3300025944 Bacteria 642
70 Ga0207712_10948058 3300025961 Bacteria 762
71 Ga0207668_10003127 3300025972 Bacteria 9689
72 Ga0207640_10231077 3300025981 Bacteria 1423
73 Ga0207677_10326218 3300026023 Bacteria 1278
74 Ga0207703_10615865 3300026035 Bacteria 1028
75 Ga0207703_11141990 3300026035 Bacteria 749
76 Ga0207678_10023145 3300026067 Bacteria 5434
77 Ga0207676_10022002 3300026095 Bacteria 4685
78 Ga0207683_10383489 3300026121 Bacteria 1292
79 Ga0207683_10416091 3300026121 Bacteria 1238
80 Ga0207698_11492207 3300026142 Bacteria 691
81 Ga0268266_10034936 3300028379 Bacteria 4276
82 Ga0268266_11253868 3300028379 Bacteria 717
83 Ga0268265_10039456 3300028380 Bacteria 3481
84 Ga0307517_10393594 3300028786 Bacteria 736
85 Ga0307515_10000454 3300028794 Bacteria 97728
86 Ga0307515_10094409 3300028794 Bacteria 3695
87 Ga0265327_10000001 3300031251 Bacteria 894475
88 Ga0307513_10356770 3300031456 Bacteria 1208
89 Ga0307408_100506396 3300031548 Bacteria 1058
90 Ga0307508_10001533 3300031616 Bacteria 25846
91 Ga0307508_10015908 3300031616 Bacteria 6854
92 Ga0307514_10283728 3300031649 Bacteria 945
93 Ga0307514_10300060 3300031649 Bacteria 901
94 Ga0307516_10003528 3300031730 Bacteria 20028
95 Ga0307516_10013684 3300031730 Bacteria 8622
96 Ga0307516_10291197 3300031730 Bacteria 1311
97 Ga0307516_10513967 3300031730 Bacteria 851
98 Ga0307405_10095730 3300031731 Bacteria 1978
99 Ga0307405_10445025 3300031731 Bacteria 1026
100 Ga0307405_10640920 3300031731 Bacteria 872
101 Ga0307413_10181274 3300031824 Bacteria 1502
102 Ga0307413_10260626 3300031824 Bacteria 1292
103 Ga0307413_10933482 3300031824 Bacteria 739
104 Ga0307410_10264198 3300031852 Bacteria 1343
105 Ga0307410_10291723 3300031852 Bacteria 1284
106 Ga0307406_11036556 3300031901 Bacteria 705
107 Ga0307407_10099978 3300031903 Bacteria 1798
108 Ga0307409_100177356 3300031995 Bacteria 1882
109 Ga0307409_100747670 3300031995 Bacteria 981
110 Ga0307409_102390278 3300031995 Bacteria 557
111 Ga0307416_100711318 3300032002 Bacteria 1094
112 Ga0307416_101767748 3300032002 Bacteria 722
113 Ga0307416_102674960 3300032002 Bacteria 596
114 Ga0307414_10822349 3300032004 Bacteria 848
115 Ga0307414_12133875 3300032004 Bacteria 523
116 Ga0307411_10382513 3300032005 Bacteria 1158
117 Ga0307415_100141344 3300032126 Bacteria 1839
118 Ga0373940_0036716 3300035088 Bacteria 1331
119 Ga0373951_0000601 3300035091 Bacteria 9891
120 Ga0373939_0258581 3300035114 Bacteria 680
121 Ga0373942_0001056 3300035207 Bacteria 7413
122 Ga0373962_0006373 3300035242 Bacteria 2858
123 Ga0373935_0016605 3300035692 Bacteria 4455
124 Ga0395900_0342567 3300037418 Bacteria 1470
125 Ga0395898_0073230 3300037466 Bacteria 3309
126 Ga0395905_0036581 3300037471 Bacteria 4611
127 Ga0395901_0018998 3300038443 Bacteria 7026
128 Ga0451841_0433344 3300041498 Bacteria 636
129 Ga0451843_0237184 3300041509 Bacteria 670
130 Ga0451843_1480895 3300041509 Bacteria 1424
131 Ga0451853_3108463 3300041512 Bacteria 2004
132 Ga0451853_4084812 3300041512 Bacteria 1025
133 Ga0466963_0297583 3300044694 Bacteria 1135
134 Ga0466958_0673516 3300045836 Bacteria 674
135 Ga0466967_0192712 3300045976 Bacteria 1927
136 Ga0495629_0027291 3300046459 Bacteria 4054
137 Ga0496100_0520132 3300048903 Bacteria 918
138 Ga0496104_0255490 3300048907 Bacteria 1665
139 Ga0496108_0030193 3300048911 Bacteria 4492
140 Ga0496109_0002148 3300048912 Bacteria 16388
141 Ga0496110_0022691 3300048913 Bacteria 5333
142 Ga0496112_0004203 3300048915 Bacteria 12142
143 Ga0496112_0103689 3300048915 Bacteria 2814
144 Ga0496112_0113339 3300048915 Bacteria 2682
145 Ga0496112_0549096 3300048915 Bacteria 1089
146 Ga0496113_0063440 3300048916 Bacteria 2792
147 Ga0496113_0129886 3300048916 Bacteria 1976
148 Ga0501041_0344861 3300049577 Bacteria 941
149 Ga0501047_0389526 3300049581 Bacteria 1227
150 nmdc:mga09592_1300289_c1 3300050508 Bacteria 598
151 nmdc:mga0qj67_56593_c1 3300050509 Bacteria 3108
152 nmdc:mga06r32_756143_c1 3300050510 Bacteria 935
153 Ga0495655_0092201 3300053083 Bacteria 884
154 Ga0500572_094122 3300053111 Bacteria 952

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100681475 Ga0070683_1006814752 125
2 3300005337 Ga0070682_100019349 Ga0070682_1000193494 125
3 3300005338 Ga0068868_100181153 Ga0068868_1001811532 125
4 3300005354 Ga0070675_100246524 Ga0070675_1002465242 125
5 3300005366 Ga0070659_100181973 Ga0070659_1001819732 125
6 3300005455 Ga0070663_100092727 Ga0070663_1000927272 125
7 3300005578 Ga0068854_100251921 Ga0068854_1002519212 125
8 3300005615 Ga0070702_100184372 Ga0070702_1001843722 125
9 3300005616 Ga0068852_100226880 Ga0068852_1002268801 125
10 3300005842 Ga0068858_100878449 Ga0068858_1008784492 125
11 3300009098 Ga0105245_10165619 Ga0105245_101656192 125
12 3300009551 Ga0105238_10135299 Ga0105238_101352992 125
13 3300009553 Ga0105249_10360971 Ga0105249_103609712 125
14 3300011119 Ga0105246_10318042 Ga0105246_103180422 125
15 3300014745 Ga0157377_11029798 Ga0157377_110297981 125
16 3300014969 Ga0157376_10707326 Ga0157376_107073262 125
17 3300025909 Ga0207705_10240223 Ga0207705_102402231 125
18 3300025926 Ga0207659_10465311 Ga0207659_104653111 125
19 3300025927 Ga0207687_10196060 Ga0207687_101960603 125
20 3300025944 Ga0207661_10599270 Ga0207661_105992702 125
21 3300025961 Ga0207712_10948058 Ga0207712_109480582 125
22 3300025981 Ga0207640_10231077 Ga0207640_102310772 125
23 3300026023 Ga0207677_10326218 Ga0207677_103262182 125
24 3300026035 Ga0207703_11141990 Ga0207703_111419901 125
25 3300026067 Ga0207678_10023145 Ga0207678_100231457 125
26 3300026121 Ga0207683_10383489 Ga0207683_103834892 125
27 3300048911 Ga0496108_0030193 Ga0496108_0030193_3349_3777 125
28 3300048912 Ga0496109_0002148 Ga0496109_0002148_1001_1429 125
29 3300048913 Ga0496110_0022691 Ga0496110_0022691_1469_1897 125
30 3300048915 Ga0496112_0113339 Ga0496112_0113339_822_1250 125
31 3300053083 Ga0495655_0092201 Ga0495655_0092201_21_449 125
32 iso_pu_bacteria 2675903059 2676482960 132
33 3300050508 nmdc:mga09592_1300289_c1 nmdc:mga09592_1300289_c1_168_575 135
34 3300050509 nmdc:mga0qj67_56593_c1 nmdc:mga0qj67_56593_c1_2225_2632 135
35 3300005435 Ga0070714_100697861 Ga0070714_1006978611 136
36 3300006847 Ga0075431_100955241 Ga0075431_1009552411 136
37 3300013308 Ga0157375_12372129 Ga0157375_123721292 136
38 3300013308 Ga0157375_12517795 Ga0157375_125177952 136
39 3300026121 Ga0207683_10416091 Ga0207683_104160912 136
40 3300031824 Ga0307413_10260626 Ga0307413_102606263 136
41 3300031824 Ga0307413_10933482 Ga0307413_109334822 136
42 3300031852 Ga0307410_10264198 Ga0307410_102641983 136
43 3300031995 Ga0307409_102390278 Ga0307409_1023902782 136
44 3300032002 Ga0307416_101767748 Ga0307416_1017677481 136
45 3300032005 Ga0307411_10382513 Ga0307411_103825132 136
46 3300048903 Ga0496100_0520132 Ga0496100_0520132_125_535 136
47 3300025944 Ga0207661_11083449 Ga0207661_110834491 137
48 3300035091 Ga0373951_0000601 Ga0373951_0000601_2318_2731 137
49 3300041509 Ga0451843_0237184 Ga0451843_0237184_220_651 137
50 3300005937 Ga0081455_10559590 Ga0081455_105595902 138
51 3300031731 Ga0307405_10640920 Ga0307405_106409202 138
52 3300031824 Ga0307413_10181274 Ga0307413_101812741 138
53 3300032126 Ga0307415_100141344 Ga0307415_1001413442 138
54 3300005355 Ga0070671_101563913 Ga0070671_1015639131 139
55 3300005548 Ga0070665_100160242 Ga0070665_1001602422 139
56 3300005618 Ga0068864_100045376 Ga0068864_1000453765 139
57 3300005841 Ga0068863_100293717 Ga0068863_1002937172 139
58 3300005985 Ga0081539_10032254 Ga0081539_100322542 139
59 3300006844 Ga0075428_100216587 Ga0075428_1002165872 139
60 3300006847 Ga0075431_100172819 Ga0075431_1001728193 139
61 3300009093 Ga0105240_11202336 Ga0105240_112023361 139
62 3300014325 Ga0163163_10203027 Ga0163163_102030273 139
63 3300014325 Ga0163163_10497382 Ga0163163_104973822 139
64 3300025931 Ga0207644_11766154 Ga0207644_117661542 139
65 3300025935 Ga0207709_11340252 Ga0207709_113402521 139
66 3300026095 Ga0207676_10022002 Ga0207676_100220025 139
67 3300028379 Ga0268266_10034936 Ga0268266_100349364 139
68 3300028379 Ga0268266_11253868 Ga0268266_112538681 139
69 3300028786 Ga0307517_10393594 Ga0307517_103935941 139
70 3300031456 Ga0307513_10356770 Ga0307513_103567702 139
71 3300031548 Ga0307408_100506396 Ga0307408_1005063962 139
72 3300031616 Ga0307508_10015908 Ga0307508_100159082 139
73 3300031730 Ga0307516_10013684 Ga0307516_100136844 139
74 3300031730 Ga0307516_10513967 Ga0307516_105139672 139
75 3300031731 Ga0307405_10095730 Ga0307405_100957302 139
76 3300031852 Ga0307410_10291723 Ga0307410_102917232 139
77 3300031901 Ga0307406_11036556 Ga0307406_110365561 139
78 3300031903 Ga0307407_10099978 Ga0307407_100999782 139
79 3300031995 Ga0307409_100177356 Ga0307409_1001773562 139
80 3300031995 Ga0307409_100747670 Ga0307409_1007476702 139
81 3300032002 Ga0307416_100711318 Ga0307416_1007113182 139
82 3300032002 Ga0307416_102674960 Ga0307416_1026749602 139
83 3300032004 Ga0307414_10822349 Ga0307414_108223492 139
84 3300032004 Ga0307414_12133875 Ga0307414_121338751 139
85 3300037418 Ga0395900_0342567 Ga0395900_0342567_216_635 139
86 3300037466 Ga0395898_0073230 Ga0395898_0073230_722_1141 139
87 3300037471 Ga0395905_0036581 Ga0395905_0036581_466_885 139
88 3300038443 Ga0395901_0018998 Ga0395901_0018998_4356_4775 139
89 3300048907 Ga0496104_0255490 Ga0496104_0255490_172_591 139
90 3300048915 Ga0496112_0004203 Ga0496112_0004203_8786_9205 139
91 3300048915 Ga0496112_0103689 Ga0496112_0103689_2255_2674 139
92 3300048915 Ga0496112_0549096 Ga0496112_0549096_419_838 139
93 3300048916 Ga0496113_0063440 Ga0496113_0063440_960_1379 139
94 3300048916 Ga0496113_0129886 Ga0496113_0129886_1182_1601 139
95 3300050510 nmdc:mga06r32_756143_c1 nmdc:mga06r32_756143_c1_75_494 139
96 3300005347 Ga0070668_101023245 Ga0070668_1010232452 140
97 3300005842 Ga0068858_101066586 Ga0068858_1010665862 140
98 3300005985 Ga0081539_10002231 Ga0081539_100022317 140
99 3300006358 Ga0068871_101714371 Ga0068871_1017143711 140
100 3300013308 Ga0157375_11249047 Ga0157375_112490472 140
101 3300014968 Ga0157379_10339700 Ga0157379_103397002 140
102 3300014969 Ga0157376_11405867 Ga0157376_114058672 140
103 3300025901 Ga0207688_10077389 Ga0207688_100773894 140
104 3300026035 Ga0207703_10615865 Ga0207703_106158652 140
105 3300044694 Ga0466963_0297583 Ga0466963_0297583_441_866 140
106 3300045976 Ga0466967_0192712 Ga0466967_0192712_804_1229 140
107 3300003203 JGI25406J46586_10049969 JGI25406J46586_100499692 141
108 3300003203 JGI25406J46586_10059808 JGI25406J46586_100598082 141
109 3300005336 Ga0070680_100867852 Ga0070680_1008678522 141
110 3300005347 Ga0070668_100001464 Ga0070668_10000146416 141
111 3300005367 Ga0070667_100118613 Ga0070667_1001186132 141
112 3300005545 Ga0070695_100487603 Ga0070695_1004876031 141
113 3300005548 Ga0070665_101946882 Ga0070665_1019468821 141
114 3300005844 Ga0068862_100263345 Ga0068862_1002633452 141
115 3300005985 Ga0081539_10003194 Ga0081539_100031945 141
116 3300006028 Ga0070717_10819857 Ga0070717_108198572 141
117 3300009101 Ga0105247_10576367 Ga0105247_105763672 141
118 3300009177 Ga0105248_10170273 Ga0105248_101702732 141
119 3300014968 Ga0157379_10755046 Ga0157379_107550462 141
120 3300025917 Ga0207660_11365416 Ga0207660_113654162 141
121 3300025941 Ga0207711_10119762 Ga0207711_101197622 141
122 3300025972 Ga0207668_10003127 Ga0207668_100031278 141
123 3300028380 Ga0268265_10039456 Ga0268265_100394564 141
124 3300031251 Ga0265327_10000001 Ga0265327_10000001790 141
125 3300031616 Ga0307508_10001533 Ga0307508_100015335 141
126 3300035088 Ga0373940_0036716 Ga0373940_0036716_525_950 141
127 3300035114 Ga0373939_0258581 Ga0373939_0258581_62_487 141
128 3300035207 Ga0373942_0001056 Ga0373942_0001056_104_529 141
129 3300035242 Ga0373962_0006373 Ga0373962_0006373_961_1386 141
130 3300045836 Ga0466958_0673516 Ga0466958_0673516_90_515 141
131 3300049577 Ga0501041_0344861 Ga0501041_0344861_298_723 141
132 3300049581 Ga0501047_0389526 Ga0501047_0389526_534_962 141
133 3300053111 Ga0500572_094122 Ga0500572_094122_259_684 141
134 3300005937 Ga0081455_10410399 Ga0081455_104103992 142
135 3300035692 Ga0373935_0016605 Ga0373935_0016605_3531_3959 142
136 3300002067 JGI24735J21928_10071240 JGI24735J21928_100712401 143
137 3300005338 Ga0068868_100606799 Ga0068868_1006067991 143
138 3300005548 Ga0070665_100073420 Ga0070665_1000734203 143
139 3300006844 Ga0075428_100444259 Ga0075428_1004442591 143
140 3300006846 Ga0075430_100560801 Ga0075430_1005608012 143
141 3300022467 Ga0224712_10091882 Ga0224712_100918822 143
142 3300025944 Ga0207661_11400198 Ga0207661_114001981 143
143 3300026142 Ga0207698_11492207 Ga0207698_114922072 143
144 3300028794 Ga0307515_10000454 Ga0307515_1000045485 143
145 3300028794 Ga0307515_10094409 Ga0307515_100944091 143
146 3300031649 Ga0307514_10283728 Ga0307514_102837281 143
147 3300031649 Ga0307514_10300060 Ga0307514_103000602 143
148 3300031730 Ga0307516_10003528 Ga0307516_100035281 143
149 3300031730 Ga0307516_10291197 Ga0307516_102911972 143
150 3300031731 Ga0307405_10445025 Ga0307405_104450252 143
151 3300041498 Ga0451841_0433344 Ga0451841_0433344_47_478 143
152 3300041509 Ga0451843_1480895 Ga0451843_1480895_400_831 143
153 3300041512 Ga0451853_3108463 Ga0451853_3108463_1179_1616 143
154 3300041512 Ga0451853_4084812 Ga0451853_4084812_206_691 143
155 3300046459 Ga0495629_0027291 Ga0495629_0027291_1836_2273 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02391

MoaE

MoaE protein

30

141

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jbz-assembly1.cif.gz_C structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.969 7 141
6jc0-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9661 6 141
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.959 7 141
6jc0-assembly1.cif.gz_D structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.9262 6 141
6jc0-assembly1.cif.gz_B structural analysis of molybdopterin synthases from two mycobacteria pathogens 0.925 7 141
ID Description Score Start End Superfamily
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.967 8 143 3.90.1170.40
af_P9WJR1_4_141_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9465 8 143 3.90.1170.40
af_P91500_195_340_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9404 9 140 3.90.1170.40
af_Q6AY59_40_191_3.90.1170.40 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9228 6 140 3.90.1170.40
2qieK00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.9226 12 140 3.90.1170.40
ID Description Score Start End GO Terms
AF-A0A428YJP4-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.995 8 143 GO:0006777
AF-A0A1C6REY6-F1-model_v4 Molybdopterin synthase subunit MoaE 0.9894 9 143 GO:0006777
AF-A0A2W6BIA4-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9882 7 140 GO:0006777
AF-A0A7X7V7G9-F1-model_v4 Molybdenum cofactor biosynthesis protein MoaE 0.9848 50 141 GO:0006777
AF-A0A4S3G7H7-F1-model_v4 deleted 0.9836 5 140

Feature Viewer

pLDDT pTM Quality
94.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map