F220856

General Info

Members Datasets Scaffolds Average Seq Length
154 84 136 313

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0338610|Ga0501082_0338610_106_1182
Length 358
Sequence MMVYTTTLRVSQRAVGVISSLPSCVVCGVQSAIVATHPFPRENMAELSSETRFLHAVEMGLGAWQWGDRVVWQYGHGYGDMEVRQAFQVALEEGIRFVDTAEIYGNGRSERLLGQFLKGTDQPVLIATKFLPFPWRFGKGALPRALKGSLSRLGVDSVDLYQIHWPTPLMSIETMMEGLAQCVHSGMTRTAGVSNFGQTSLLAAYSALARHNIPLASNQVHYSLLNRTVEKNGLLARCKELGIRLIAYSPIEKGLLTGKYTAASPPPGSRARIYASLLPKIGPLLKLMTEIGQDYGGKSNAQVALNWVICKGALAIPGAKNAQQAQENAGALGWKLTEEEVSRLDQASDAILESQKAQ

Samples

Sample ID Description Type Environment
1 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
2 2831426010 Nostoc sp. 106C Isolate Unclassified
3 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
4 2849660919 Nostoc sp. T09 Isolate Unclassified
5 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
6 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
7 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
8 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003556 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_09_fullP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003560 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_13_lowP_nobac_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003561 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_01_fullP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003564 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_05_lowP_nobac_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
60 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
63 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
76 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
77 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
78 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
79 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
80 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
81 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
82 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
83 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
84 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.42
Metatranscriptomes 3.9
Isolates 11.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 87.01
Stem 0
Stem Tuber 0
Unclassified 12.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10003219 3300003203 Bacteria 7680
2 Ga0006556J51387_1025598 3300003479 Eukaryota 1294
3 Ga0006557J51388_1022993 3300003556 Eukaryota 1328
4 Ga0006559J51393_1027732 3300003560 Eukaryota 1318
5 Ga0006553J51392_1024920 3300003561 Eukaryota 1265
6 Ga0006555J51386_1023254 3300003564 Eukaryota 1296
7 Ga0006554J51385_1022603 3300003567 Eukaryota 1312
8 Ga0065707_10000721 3300005295 Bacteria 12558
9 Ga0065707_10088286 3300005295 Bacteria 4707
10 Ga0065707_10133380 3300005295 Bacteria 1882
11 Ga0070682_100154339 3300005337 Bacteria 1579
12 Ga0070705_100029998 3300005440 Bacteria 2999
13 Ga0070706_100074710 3300005467 Bacteria 3137
14 Ga0070707_100041355 3300005468 Bacteria 4411
15 Ga0070707_100111595 3300005468 Bacteria 2652
16 Ga0070698_100020514 3300005471 Bacteria 6928
17 Ga0070698_100136450 3300005471 Bacteria 2407
18 Ga0070699_100001639 3300005518 Bacteria 20416
19 Ga0070699_100040045 3300005518 Bacteria 4058
20 Ga0070699_100096962 3300005518 Bacteria 2583
21 Ga0070695_100017529 3300005545 Bacteria 4344
22 Ga0081539_10003397 3300005985 Bacteria 19660
23 Ga0075427_10002164 3300006194 Bacteria 2610
24 Ga0075428_100029477 3300006844 Bacteria 6072
25 Ga0075428_100151410 3300006844 Unclassified 2520
26 Ga0075430_100103109 3300006846 Bacteria 2382
27 Ga0075431_100042142 3300006847 Bacteria 4707
28 Ga0075431_100154127 3300006847 Bacteria 2365
29 Ga0075431_100187140 3300006847 Bacteria 2123
30 Ga0075433_10025658 3300006852 Bacteria 4983
31 Ga0075434_100055121 3300006871 Bacteria 3950
32 Ga0075429_100019167 3300006880 Bacteria 5927
33 Ga0075429_100031912 3300006880 Bacteria 4579
34 Ga0075429_100041363 3300006880 Bacteria 4014
35 Ga0075429_100134887 3300006880 Unclassified 2160
36 Ga0111539_10148941 3300009094 Bacteria 2740
37 Ga0114129_10010871 3300009147 Bacteria 12968
38 Ga0114129_10026430 3300009147 Bacteria 8219
39 Ga0114129_10041033 3300009147 Bacteria 6522
40 Ga0114129_10082152 3300009147 Bacteria 4478
41 Ga0105243_10025344 3300009148 Bacteria 4531
42 Ga0105243_10231999 3300009148 Bacteria 1638
43 Ga0105242_10107297 3300009176 Bacteria 2375
44 Ga0105249_10264819 3300009553 Bacteria 1709
45 Ga0105246_10044195 3300011119 Bacteria 3026
46 Ga0207684_10109304 3300025910 Bacteria 2366
47 Ga0207646_10059730 3300025922 Bacteria 3405
48 Ga0207646_10123541 3300025922 Bacteria 2327
49 Ga0207686_10370946 3300025934 Unclassified 1083
50 Ga0207712_10137737 3300025961 Unclassified 1869
51 Ga0207712_10175208 3300025961 Bacteria 1680
52 Ga0207674_10297696 3300026116 Unclassified 1562
53 Ga0207675_100274212 3300026118 Bacteria 1638
54 Ga0265337_1008978 3300028556 Bacteria 3597
55 Ga0265326_10004581 3300028558 Bacteria 4418
56 Ga0265319_1000173 3300028563 Bacteria 49147
57 Ga0265319_1018485 3300028563 Unclassified 2623
58 Ga0265334_10003715 3300028573 Bacteria 6909
59 Ga0265318_10007630 3300028577 Bacteria 4873
60 Ga0265318_10021288 3300028577 Bacteria 2604
61 Ga0265336_10009126 3300028666 Bacteria 3442
62 Ga0265336_10032830 3300028666 Unclassified 1609
63 Ga0265338_10002126 3300028800 Bacteria 30416
64 Ga0265320_10114216 3300031240 Bacteria 1235
65 Ga0265340_10009113 3300031247 Bacteria 5336
66 Ga0265316_10155699 3300031344 Unclassified 1710
67 Ga0316576_10099286 3300031727 Bacteria 2175
68 Ga0316578_10222332 3300031728 Unclassified 1135
69 Ga0307410_10177350 3300031852 Bacteria 1611
70 Ga0307410_10196805 3300031852 Bacteria 1536
71 Ga0307409_100109824 3300031995 Bacteria 2310
72 Ga0307415_100471611 3300032126 Unclassified 1090
73 Ga0373923_0001546 3300035111 Bacteria 6661
74 Ga0373923_0021151 3300035111 Bacteria 2536
75 Ga0373931_0006545 3300035691 Bacteria 5447
76 Ga0373931_0075056 3300035691 Unclassified 1853
77 Ga0373937_0066934 3300036401 Bacteria 3309
78 Ga0373937_0178386 3300036401 Bacteria 1994
79 Ga0316582_0003502 3300036647 Bacteria 7706
80 Ga0316582_0060636 3300036647 Bacteria 2426
81 Ga0316584_0009836 3300036712 Bacteria 6657
82 Ga0316584_0119948 3300036712 Bacteria 1966
83 Ga0436364_0843158 3300037853 Bacteria 4877
84 Ga0436363_0163519 3300039450 Bacteria 1590
85 Ga0451577_0183118 3300042876 Bacteria 1889
86 Ga0451577_0487650 3300042876 Bacteria 1119
87 Ga0451577_0522911 3300042876 Unclassified 1077
88 Ga0451577_0527078 3300042876 Unclassified 1073
89 Ga0453683_0004524 3300044673 Bacteria 9845
90 Ga0453683_0024175 3300044673 Bacteria 3869
91 Ga0453683_0025927 3300044673 Bacteria 3722
92 Ga0453683_0246581 3300044673 Bacteria 1138
93 Ga0453684_0000007 3300044712 Bacteria 1301482
94 Ga0453684_0000484 3300044712 Bacteria 157641
95 Ga0453684_0002604 3300044712 Bacteria 43124
96 Ga0453684_0003918 3300044712 Bacteria 32700
97 Ga0453684_0006243 3300044712 Bacteria 22834
98 Ga0453684_0019386 3300044712 Bacteria 10359
99 Ga0453684_0058167 3300044712 Bacteria 4995
100 Ga0453684_0074990 3300044712 Bacteria 4255
101 Ga0453684_0093613 3300044712 Bacteria 3700
102 Ga0453684_0132609 3300044712 Bacteria 2987
103 Ga0453684_0132911 3300044712 Bacteria 2984
104 Ga0453684_0167383 3300044712 Bacteria 2594
105 Ga0453684_0171061 3300044712 Bacteria 2560
106 Ga0453684_0234764 3300044712 Bacteria 2115
107 Ga0453684_0256933 3300044712 Unclassified 2003
108 Ga0453684_0556684 3300044712 Bacteria 1262
109 Ga0453684_0570400 3300044712 Unclassified 1244
110 Ga0451576_0000273 3300045051 Bacteria 126460
111 Ga0451576_0006383 3300045051 Bacteria 14479
112 Ga0451576_0015407 3300045051 Bacteria 8468
113 Ga0451576_0240665 3300045051 Unclassified 1890
114 Ga0451576_0595213 3300045051 Unclassified 1162
115 Ga0495630_0131979 3300046517 Bacteria 1897
116 Ga0501040_0200266 3300049576 Bacteria 1418
117 Ga0501046_0065402 3300049580 Bacteria 2837
118 Ga0501075_0046897 3300049591 Bacteria 3247
119 Ga0501076_0011548 3300049592 Bacteria 6585
120 Ga0501076_0193400 3300049592 Bacteria 1661
121 Ga0501077_0240991 3300049593 Bacteria 1150
122 nmdc:mga05p37_42894_c1 3300050507 Bacteria 5561
123 nmdc:mga05p37_49945_c1 3300050507 Bacteria 5145
124 nmdc:mga09592_175665_c1 3300050508 Unclassified 1853
125 nmdc:mga09592_33867_c1 3300050508 Bacteria 4268
126 nmdc:mga09592_5174_c1 3300050508 Bacteria 10600
127 nmdc:mga0qj67_207845_c1 3300050509 Bacteria 1590
128 nmdc:mga06r32_173370_c1 3300050510 Bacteria 2141
129 nmdc:mga06r32_83428_c1 3300050510 Bacteria 3114
130 nmdc:mga0n895_567752_c1 3300050512 Bacteria 1139
131 nmdc:mga0n895_92978_c1 3300050512 Bacteria 3019
132 nmdc:mga0a205_288647_c1 3300050515 Bacteria 1515
133 nmdc:mga0a205_294601_c1 3300050515 Bacteria 1496
134 Ga0501084_0137492 3300054114 Unclassified 2057
135 Ga0501082_0338610 3300060353 Bacteria 1311
136 Ga0501082_0377829 3300060353 Bacteria 1236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003560 Ga0006559J51393_1027732 Ga0006559J51393_10277322 264
2 3300036401 Ga0373937_0178386 Ga0373937_0178386_439_1329 273
3 3300045051 Ga0451576_0015407 Ga0451576_0015407_2678_3568 273
4 iso_pu_bacteria 642555144 642600077 288
5 3300035691 Ga0373931_0006545 Ga0373931_0006545_1706_2620 292
6 3300003556 Ga0006557J51388_1022993 Ga0006557J51388_10229932 293
7 3300003567 Ga0006554J51385_1022603 Ga0006554J51385_10226032 293
8 3300009147 Ga0114129_10082152 Ga0114129_100821523 295
9 3300009553 Ga0105249_10264819 Ga0105249_102648192 295
10 3300026118 Ga0207675_100274212 Ga0207675_1002742122 295
11 3300042876 Ga0451577_0522911 Ga0451577_0522911_45_932 295
12 3300049593 Ga0501077_0240991 Ga0501077_0240991_251_1138 295
13 3300050508 nmdc:mga09592_5174_c1 nmdc:mga09592_5174_c1_6469_7356 295
14 3300054114 Ga0501084_0137492 Ga0501084_0137492_110_997 295
15 iso_pu_bacteria 2617270889 2617913986 299
16 iso_pu_bacteria 2831426010 2831428357 299
17 iso_pu_bacteria 2848694841 2848698532 299
18 iso_pu_bacteria 2849660919 2849664765 299
19 iso_pu_bacteria 2886627955 2886628756 299
20 iso_pu_bacteria 2913844669 2913849850 299
21 iso_pu_bacteria 2913912277 2913914196 299
22 iso_pu_bacteria 2913939268 2913941107 299
23 3300049580 Ga0501046_0065402 Ga0501046_0065402_1743_2645 300
24 3300049592 Ga0501076_0011548 Ga0501076_0011548_1167_2069 300
25 3300003479 Ga0006556J51387_1025598 Ga0006556J51387_10255981 301
26 3300003561 Ga0006553J51392_1024920 Ga0006553J51392_10249201 301
27 3300003564 Ga0006555J51386_1023254 Ga0006555J51386_10232541 301
28 3300035111 Ga0373923_0021151 Ga0373923_0021151_669_1676 301
29 3300044673 Ga0453683_0246581 Ga0453683_0246581_73_1053 301
30 3300028556 Ga0265337_1008978 Ga0265337_10089782 303
31 3300028558 Ga0265326_10004581 Ga0265326_100045812 303
32 3300028563 Ga0265319_1000173 Ga0265319_100017331 303
33 3300028577 Ga0265318_10021288 Ga0265318_100212882 303
34 3300028666 Ga0265336_10009126 Ga0265336_100091262 303
35 3300028666 Ga0265336_10032830 Ga0265336_100328301 303
36 3300028800 Ga0265338_10002126 Ga0265338_100021264 303
37 3300031240 Ga0265320_10114216 Ga0265320_101142162 303
38 3300035691 Ga0373931_0075056 Ga0373931_0075056_711_1625 303
39 3300036712 Ga0316584_0119948 Ga0316584_0119948_131_1066 303
40 iso_pu_bacteria 2617270889 2617914424 304
41 iso_pu_bacteria 2886627955 2886632494 304
42 iso_pu_bacteria 2913844669 2913852057 304
43 iso_pu_bacteria 2913912277 2913912528 304
44 iso_pu_bacteria 2913939268 2913942821 304
45 iso_pu_bacteria 642555144 642603484 304
46 3300044712 Ga0453684_0003918 Ga0453684_0003918_2178_3110 305
47 3300035111 Ga0373923_0001546 Ga0373923_0001546_3881_4828 308
48 3300036401 Ga0373937_0066934 Ga0373937_0066934_957_1904 308
49 3300037853 Ga0436364_0843158 Ga0436364_0843158_995_1942 308
50 3300039450 Ga0436363_0163519 Ga0436363_0163519_604_1551 308
51 iso_pu_bacteria 2831426010 2831431038 308
52 iso_pu_bacteria 2848694841 2848701384 308
53 iso_pu_bacteria 2849660919 2849667659 308
54 3300044712 Ga0453684_0000484 Ga0453684_0000484_82382_83332 309
55 3300044712 Ga0453684_0006243 Ga0453684_0006243_12192_13163 309
56 3300003203 JGI25406J46586_10003219 JGI25406J46586_100032192 310
57 3300005295 Ga0065707_10000721 Ga0065707_100007214 310
58 3300005295 Ga0065707_10088286 Ga0065707_100882863 310
59 3300005295 Ga0065707_10133380 Ga0065707_101333801 310
60 3300005337 Ga0070682_100154339 Ga0070682_1001543391 310
61 3300005440 Ga0070705_100029998 Ga0070705_1000299982 310
62 3300005467 Ga0070706_100074710 Ga0070706_1000747102 310
63 3300005468 Ga0070707_100041355 Ga0070707_1000413553 310
64 3300005468 Ga0070707_100111595 Ga0070707_1001115952 310
65 3300005471 Ga0070698_100020514 Ga0070698_1000205142 310
66 3300005471 Ga0070698_100136450 Ga0070698_1001364503 310
67 3300005518 Ga0070699_100001639 Ga0070699_10000163911 310
68 3300005518 Ga0070699_100040045 Ga0070699_1000400453 310
69 3300005518 Ga0070699_100096962 Ga0070699_1000969623 310
70 3300005545 Ga0070695_100017529 Ga0070695_1000175294 310
71 3300005985 Ga0081539_10003397 Ga0081539_100033977 310
72 3300006194 Ga0075427_10002164 Ga0075427_100021642 310
73 3300006844 Ga0075428_100029477 Ga0075428_1000294774 310
74 3300006844 Ga0075428_100151410 Ga0075428_1001514103 310
75 3300006846 Ga0075430_100103109 Ga0075430_1001031092 310
76 3300006847 Ga0075431_100042142 Ga0075431_1000421422 310
77 3300006847 Ga0075431_100154127 Ga0075431_1001541272 310
78 3300006847 Ga0075431_100187140 Ga0075431_1001871401 310
79 3300006852 Ga0075433_10025658 Ga0075433_100256583 310
80 3300006871 Ga0075434_100055121 Ga0075434_1000551213 310
81 3300006880 Ga0075429_100019167 Ga0075429_1000191673 310
82 3300006880 Ga0075429_100031912 Ga0075429_1000319124 310
83 3300006880 Ga0075429_100041363 Ga0075429_1000413632 310
84 3300006880 Ga0075429_100134887 Ga0075429_1001348872 310
85 3300009094 Ga0111539_10148941 Ga0111539_101489411 310
86 3300009147 Ga0114129_10010871 Ga0114129_100108712 310
87 3300009147 Ga0114129_10026430 Ga0114129_100264304 310
88 3300009147 Ga0114129_10041033 Ga0114129_100410334 310
89 3300009148 Ga0105243_10025344 Ga0105243_100253442 310
90 3300009148 Ga0105243_10231999 Ga0105243_102319992 310
91 3300009176 Ga0105242_10107297 Ga0105242_101072974 310
92 3300011119 Ga0105246_10044195 Ga0105246_100441953 310
93 3300025910 Ga0207684_10109304 Ga0207684_101093042 310
94 3300025922 Ga0207646_10059730 Ga0207646_100597303 310
95 3300025922 Ga0207646_10123541 Ga0207646_101235412 310
96 3300025934 Ga0207686_10370946 Ga0207686_103709461 310
97 3300025961 Ga0207712_10137737 Ga0207712_101377372 310
98 3300025961 Ga0207712_10175208 Ga0207712_101752082 310
99 3300026116 Ga0207674_10297696 Ga0207674_102976961 310
100 3300028563 Ga0265319_1018485 Ga0265319_10184852 310
101 3300028573 Ga0265334_10003715 Ga0265334_100037153 310
102 3300028577 Ga0265318_10007630 Ga0265318_100076303 310
103 3300031247 Ga0265340_10009113 Ga0265340_100091133 310
104 3300031344 Ga0265316_10155699 Ga0265316_101556991 310
105 3300031727 Ga0316576_10099286 Ga0316576_100992862 310
106 3300031728 Ga0316578_10222332 Ga0316578_102223321 310
107 3300031852 Ga0307410_10177350 Ga0307410_101773502 310
108 3300031852 Ga0307410_10196805 Ga0307410_101968052 310
109 3300031995 Ga0307409_100109824 Ga0307409_1001098243 310
110 3300032126 Ga0307415_100471611 Ga0307415_1004716111 310
111 3300036647 Ga0316582_0003502 Ga0316582_0003502_5388_6323 310
112 3300036647 Ga0316582_0060636 Ga0316582_0060636_1281_2222 310
113 3300036712 Ga0316584_0009836 Ga0316584_0009836_3654_4589 310
114 3300042876 Ga0451577_0183118 Ga0451577_0183118_446_1396 310
115 3300042876 Ga0451577_0487650 Ga0451577_0487650_111_1043 310
116 3300042876 Ga0451577_0527078 Ga0451577_0527078_64_996 310
117 3300044673 Ga0453683_0004524 Ga0453683_0004524_255_1199 310
118 3300044673 Ga0453683_0024175 Ga0453683_0024175_2883_3845 310
119 3300044673 Ga0453683_0025927 Ga0453683_0025927_2666_3610 310
120 3300044712 Ga0453684_0000007 Ga0453684_0000007_948312_949250 310
121 3300044712 Ga0453684_0002604 Ga0453684_0002604_41853_42797 310
122 3300044712 Ga0453684_0019386 Ga0453684_0019386_4402_5373 310
123 3300044712 Ga0453684_0058167 Ga0453684_0058167_2288_3229 310
124 3300044712 Ga0453684_0074990 Ga0453684_0074990_2258_3193 310
125 3300044712 Ga0453684_0093613 Ga0453684_0093613_1422_2372 310
126 3300044712 Ga0453684_0132609 Ga0453684_0132609_2018_2968 310
127 3300044712 Ga0453684_0132911 Ga0453684_0132911_88_1023 310
128 3300044712 Ga0453684_0167383 Ga0453684_0167383_224_1156 310
129 3300044712 Ga0453684_0171061 Ga0453684_0171061_1082_2026 310
130 3300044712 Ga0453684_0234764 Ga0453684_0234764_44_979 310
131 3300044712 Ga0453684_0256933 Ga0453684_0256933_304_1236 310
132 3300044712 Ga0453684_0556684 Ga0453684_0556684_13_945 310
133 3300044712 Ga0453684_0570400 Ga0453684_0570400_198_1130 310
134 3300045051 Ga0451576_0000273 Ga0451576_0000273_91019_91951 310
135 3300045051 Ga0451576_0006383 Ga0451576_0006383_8630_9574 310
136 3300045051 Ga0451576_0240665 Ga0451576_0240665_257_1189 310
137 3300045051 Ga0451576_0595213 Ga0451576_0595213_66_1109 310
138 3300046517 Ga0495630_0131979 Ga0495630_0131979_227_1186 310
139 3300049576 Ga0501040_0200266 Ga0501040_0200266_311_1243 310
140 3300049591 Ga0501075_0046897 Ga0501075_0046897_500_1432 310
141 3300049592 Ga0501076_0193400 Ga0501076_0193400_413_1360 310
142 3300050507 nmdc:mga05p37_42894_c1 nmdc:mga05p37_42894_c1_3052_3987 310
143 3300050507 nmdc:mga05p37_49945_c1 nmdc:mga05p37_49945_c1_768_1700 310
144 3300050508 nmdc:mga09592_175665_c1 nmdc:mga09592_175665_c1_317_1249 310
145 3300050508 nmdc:mga09592_33867_c1 nmdc:mga09592_33867_c1_3249_4193 310
146 3300050509 nmdc:mga0qj67_207845_c1 nmdc:mga0qj67_207845_c1_61_993 310
147 3300050510 nmdc:mga06r32_173370_c1 nmdc:mga06r32_173370_c1_497_1429 310
148 3300050510 nmdc:mga06r32_83428_c1 nmdc:mga06r32_83428_c1_1040_1972 310
149 3300050512 nmdc:mga0n895_567752_c1 nmdc:mga0n895_567752_c1_46_981 310
150 3300050512 nmdc:mga0n895_92978_c1 nmdc:mga0n895_92978_c1_104_1036 310
151 3300050515 nmdc:mga0a205_288647_c1 nmdc:mga0a205_288647_c1_291_1223 310
152 3300050515 nmdc:mga0a205_294601_c1 nmdc:mga0a205_294601_c1_17_1063 310
153 3300060353 Ga0501082_0338610 Ga0501082_0338610_106_1182 310
154 3300060353 Ga0501082_0377829 Ga0501082_0377829_57_992 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

58

349

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ky6-assembly2.cif.gz_B crystal structure of a thermostable aldo-keto reductase tm1743 in complexs with inhibitor epalrestat in space group p3221cc 0.9129 15 302
3up8-assembly2.cif.gz_B crystal structure of a putative 2,5-diketo-d-gluconic acid reductase b 0.9019 12 302
4xap-assembly1.cif.gz_A crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 0.9001 15 301
1vbj-assembly2.cif.gz_B the crystal structure of prostaglandin f synthase from trypanosoma brucei 0.8847 15 302
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.8832 15 302
ID Description Score Start End Superfamily
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9644 15 306 3.20.20.100
af_Q7XCS4_50_365_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9524 15 308 3.20.20.100
af_Q0D8N4_49_369_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9121 15 306 3.20.20.100
5danA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9075 14 302 3.20.20.100
af_P9WQA7_10_309_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9072 15 306 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A530ZNY9-F1-model_v4 L-glyceraldehyde 3-phosphate reductase 0.9863 104 191 GO:0016491
GO:0051596
AF-A0A447TYR4-F1-model_v4 Ion-channel protein 0.9818 111 217 GO:0016491
GO:0051596
AF-A0A822A602-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9817 112 204 GO:0016491
AF-A0A061SEH7-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9804 15 307 GO:0004033
GO:0005737
AF-A0A6H1TZZ0-F1-model_v4 Aldo/keto reductase 0.9788 16 180 GO:0004033
GO:0005737

Feature Viewer

pLDDT pTM Quality
93.98 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map