F220355

General Info

Members Datasets Scaffolds Average Seq Length
154 115 154 194

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_022521|Ga0495627_022521_493_1158
Length 221
Sequence MSDSYNESGRSATSEKTNHLFFTFLKLNTMQKEWLDKPALLLIDIQKGFDDLEYNGGERNNPEAEHHAGQILEYWRKNKWPLFHVQHCSIVQGSPLAEGHPGNEHKEEVKPITGEPVIKKNVNSAFIGTDLKERLDTLGVRTVIIVGLTTPYCVSTTARMAGNLGYNTVVVSDATAAFRLNGLNGENIPAQVVHEISLATLNGEFAEVLSTAVILNSRVVD

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
73 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
79 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
92 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
106 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
109 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
115 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 2.6
Rhizoplane 1.95
Rhizosphere 85.06
Stem 0
Stem Tuber 0
Unclassified 6.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_4359269 2162886006 Bacteria 808
2 rootH1_10029368 3300003316 Bacteria 8105
3 rootH2_10179478 3300003320 Bacteria 1889
4 rootH1_10075420 3300003323 Bacteria 1923
5 Ga0065715_10012903 3300005293 Bacteria 2388
6 Ga0065707_10234244 3300005295 Bacteria 1177
7 Ga0070658_10000016 3300005327 Bacteria 228551
8 Ga0070666_10077532 3300005335 Bacteria 2268
9 Ga0070682_100064159 3300005337 Bacteria 2331
10 Ga0070689_100009853 3300005340 Bacteria 6792
11 Ga0070671_100007192 3300005355 Bacteria 8898
12 Ga0070671_100114796 3300005355 Bacteria 2264
13 Ga0070673_101398461 3300005364 Bacteria 658
14 Ga0070667_100015644 3300005367 Bacteria 6272
15 Ga0070678_100141739 3300005456 Bacteria 1924
16 Ga0070681_10032393 3300005458 Bacteria 5245
17 Ga0068867_100085404 3300005459 Bacteria 2386
18 Ga0070685_10003325 3300005466 Bacteria 8177
19 Ga0068855_100062150 3300005563 Unclassified 4361
20 Ga0068855_100125036 3300005563 Bacteria 2941
21 Ga0068855_100183849 3300005563 Unclassified 2362
22 Ga0068857_100506611 3300005577 Bacteria 1133
23 Ga0068859_100254380 3300005617 Bacteria 1847
24 Ga0068863_100087152 3300005841 Bacteria 2958
25 Ga0068860_100003333 3300005843 Bacteria 16537
26 Ga0068862_100520448 3300005844 Bacteria 1132
27 Ga0070716_100287925 3300006173 Bacteria 1137
28 Ga0097621_100001109 3300006237 Bacteria 18803
29 Ga0097621_100101764 3300006237 Bacteria 2418
30 Ga0097621_101255205 3300006237 Unclassified 699
31 Ga0068871_100000569 3300006358 Bacteria 25274
32 Ga0068871_100136043 3300006358 Bacteria 2087
33 Ga0075428_100180980 3300006844 Bacteria 2281
34 Ga0075433_11281511 3300006852 Bacteria 635
35 Ga0068865_100140390 3300006881 Unclassified 1821
36 Ga0068865_100359249 3300006881 Unclassified 1182
37 Ga0097620_100254391 3300006931 Bacteria 1847
38 Ga0079104_1000271 3300006946 Bacteria 67895
39 Ga0099826_10035924 3300006948 Bacteria 3515
40 Ga0105251_10065846 3300009011 Bacteria 1695
41 Ga0105250_10027433 3300009092 Bacteria 2295
42 Ga0105240_10132259 3300009093 Bacteria 2991
43 Ga0105240_11012282 3300009093 Bacteria 888
44 Ga0105240_11028369 3300009093 Bacteria 880
45 Ga0105241_10442070 3300009174 Bacteria 1149
46 Ga0105241_11195043 3300009174 Unclassified 720
47 Ga0105248_10378768 3300009177 Bacteria 1593
48 Ga0105237_10011468 3300009545 Bacteria 9375
49 Ga0105237_10095374 3300009545 Bacteria 2964
50 Ga0105238_10129965 3300009551 Bacteria 2497
51 Ga0105238_10835345 3300009551 Unclassified 938
52 Ga0105239_10005273 3300010375 Bacteria 15194
53 Ga0105239_10207076 3300010375 Bacteria 2198
54 Ga0105246_10095467 3300011119 Bacteria 2153
55 Ga0157371_10002511 3300013102 Bacteria 17428
56 Ga0157370_10004393 3300013104 Bacteria 16169
57 Ga0157370_11056956 3300013104 Bacteria 734
58 Ga0157369_10001133 3300013105 Bacteria 33334
59 Ga0157374_10093609 3300013296 Bacteria 2869
60 Ga0157374_11366317 3300013296 Bacteria 731
61 Ga0157378_10005099 3300013297 Bacteria 11534
62 Ga0157378_10007821 3300013297 Bacteria 9333
63 Ga0157378_10083975 3300013297 Unclassified 2883
64 Ga0157378_10277568 3300013297 Bacteria 1614
65 Ga0163162_10002445 3300013306 Bacteria 17518
66 Ga0163162_10026402 3300013306 Bacteria 5738
67 Ga0157372_11446360 3300013307 Bacteria 792
68 Ga0157375_10002218 3300013308 Bacteria 16810
69 Ga0157375_10434871 3300013308 Bacteria 1478
70 Ga0163163_10171801 3300014325 Unclassified 2214
71 Ga0163163_10738624 3300014325 Bacteria 1048
72 Ga0163163_10841563 3300014325 Bacteria 981
73 Ga0157380_11258896 3300014326 Bacteria 785
74 Ga0157380_11488056 3300014326 Unclassified 730
75 Ga0157377_10171680 3300014745 Bacteria 1357
76 Ga0157379_10128403 3300014968 Bacteria 2281
77 Ga0157379_10232683 3300014968 Bacteria 1671
78 Ga0157376_10000665 3300014969 Bacteria 22258
79 Ga0157376_10008493 3300014969 Bacteria 7416
80 Ga0157376_10057597 3300014969 Bacteria 3251
81 Ga0157376_10113543 3300014969 Bacteria 2389
82 Ga0157376_10250749 3300014969 Bacteria 1653
83 Ga0182006_1097617 3300015261 Bacteria 1047
84 Ga0163161_10001268 3300017792 Bacteria 18865
85 Ga0207680_10236815 3300025903 Unclassified 1256
86 Ga0207705_10000031 3300025909 Bacteria 228571
87 Ga0207707_10038124 3300025912 Bacteria 4200
88 Ga0207695_10220279 3300025913 Bacteria 1805
89 Ga0207671_10029775 3300025914 Bacteria 4075
90 Ga0207671_10054377 3300025914 Bacteria 2966
91 Ga0207644_10225780 3300025931 Bacteria 1486
92 Ga0207704_10443597 3300025938 Unclassified 1034
93 Ga0207689_10891864 3300025942 Bacteria 750
94 Ga0207667_10018689 3300025949 Bacteria 7765
95 Ga0207667_10074684 3300025949 Unclassified 3521
96 Ga0207667_10161200 3300025949 Bacteria 2307
97 Ga0207658_10008722 3300025986 Bacteria 6888
98 Ga0207658_10140749 3300025986 Unclassified 1952
99 Ga0207677_10533591 3300026023 Bacteria 1020
100 Ga0207639_10209105 3300026041 Bacteria 1678
101 Ga0207639_10920805 3300026041 Bacteria 817
102 Ga0207641_10072977 3300026088 Bacteria 2957
103 Ga0207641_10663908 3300026088 Bacteria 1025
104 Ga0207648_10125296 3300026089 Unclassified 2260
105 Ga0207683_10201498 3300026121 Bacteria 1809
106 Ga0209281_1000396 3300027111 Bacteria 67930
107 Ga0209489_113950 3300027361 Bacteria 6049
108 Ga0268265_10099573 3300028380 Unclassified 2344
109 Ga0268264_10021194 3300028381 Bacteria 5310
110 Ga0307517_10004393 3300028786 Bacteria 21657
111 Ga0265327_10000248 3300031251 Bacteria 107284
112 Ga0265327_10053499 3300031251 Bacteria 2095
113 Ga0373941_0011004 3300035115 Bacteria 2328
114 Ga0373933_0653587 3300035724 Bacteria 691
115 Ga0395900_0019209 3300037418 Bacteria 6968
116 Ga0395898_0587696 3300037466 Bacteria 1056
117 Ga0395905_0001831 3300037471 Bacteria 24563
118 Ga0395901_0506818 3300038443 Bacteria 1228
119 Ga0451843_0831380 3300041509 Bacteria 922
120 Ga0453684_0580335 3300044712 Unclassified 1231
121 Ga0451576_0002166 3300045051 Bacteria 30363
122 Ga0495627_022521 3300046453 Bacteria 2073
123 Ga0495627_145110 3300046453 Bacteria 664
124 Ga0495630_0159942 3300046517 Bacteria 1715
125 Ga0495630_0567497 3300046517 Bacteria 870
126 Ga0495643_0145843 3300046522 Unclassified 1176
127 Ga0495640_0268804 3300046533 Bacteria 1064
128 Ga0495621_0088985 3300046539 Bacteria 1162
129 Ga0495633_0000017 3300046558 Bacteria 249973
130 Ga0495657_0361543 3300046675 Bacteria 858
131 Ga0495658_0060533 3300046683 Bacteria 2172
132 Ga0495671_0138916 3300046692 Bacteria 1184
133 Ga0495674_0121742 3300047319 Bacteria 2203
134 Ga0495676_0193189 3300047321 Bacteria 1419
135 Ga0495680_0046282 3300047322 Bacteria 3431
136 Ga0495684_0035626 3300047471 Bacteria 3816
137 Ga0495686_0207844 3300047472 Bacteria 1120
138 Ga0496101_0259401 3300048904 Bacteria 1355
139 Ga0496114_0058636 3300048917 Unclassified 3215
140 Ga0496115_0083660 3300048918 Unclassified 2601
141 Ga0496117_0060174 3300048920 Bacteria 2620
142 Ga0496124_0157622 3300048927 Bacteria 1773
143 Ga0496125_0000026 3300048928 Bacteria 397380
144 Ga0496126_0005112 3300048929 Bacteria 15204
145 Ga0496126_0445959 3300048929 Bacteria 1042
146 Ga0501249_000003 3300049679 Bacteria 242930
147 Ga0495619_0066704 3300053085 Bacteria 2402
148 Ga0495619_0367972 3300053085 Bacteria 994
149 Ga0500646_0008398 3300053090 Bacteria 2638
150 Ga0500583_0328821 3300053092 Bacteria 744
151 Ga0500651_0100083 3300053093 Bacteria 1777
152 Ga0500641_0000030 3300053096 Bacteria 96500
153 Ga0500588_0004899 3300053146 Bacteria 2932
154 Ga0500624_000720 3300053157 Bacteria 8265

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10012903 Ga0065715_100129033 182
2 3300005340 Ga0070689_100009853 Ga0070689_1000098534 182
3 3300005466 Ga0070685_10003325 Ga0070685_1000332511 182
4 3300014325 Ga0163163_10171801 Ga0163163_101718011 182
5 3300014745 Ga0157377_10171680 Ga0157377_101716801 182
6 3300053157 Ga0500624_000720 Ga0500624_000720_468_1037 184
7 3300046517 Ga0495630_0567497 Ga0495630_0567497_195_764 185
8 3300005364 Ga0070673_101398461 Ga0070673_1013984611 186
9 3300005563 Ga0068855_100125036 Ga0068855_1001250363 186
10 3300005577 Ga0068857_100506611 Ga0068857_1005066112 186
11 3300006237 Ga0097621_100101764 Ga0097621_1001017643 186
12 3300014325 Ga0163163_10738624 Ga0163163_107386242 186
13 3300025949 Ga0207667_10161200 Ga0207667_101612002 186
14 3300003316 rootH1_10029368 rootH1_100293687 187
15 3300009093 Ga0105240_11028369 Ga0105240_110283692 187
16 3300014326 Ga0157380_11258896 Ga0157380_112588961 187
17 3300044712 Ga0453684_0580335 Ga0453684_0580335_301_867 187
18 3300045051 Ga0451576_0002166 Ga0451576_0002166_17141_17716 187
19 3300026089 Ga0207648_10125296 Ga0207648_101252962 188
20 2162886006 SwRhRL3b_contig_4359269 SwRhRL3b_0307.00000380 189
21 3300003320 rootH2_10179478 rootH2_101794782 189
22 3300003323 rootH1_10075420 rootH1_100754201 189
23 3300005295 Ga0065707_10234244 Ga0065707_102342442 189
24 3300005327 Ga0070658_10000016 Ga0070658_10000016155 189
25 3300005335 Ga0070666_10077532 Ga0070666_100775322 189
26 3300005337 Ga0070682_100064159 Ga0070682_1000641592 189
27 3300005355 Ga0070671_100007192 Ga0070671_1000071923 189
28 3300005355 Ga0070671_100114796 Ga0070671_1001147964 189
29 3300005367 Ga0070667_100015644 Ga0070667_1000156442 189
30 3300005456 Ga0070678_100141739 Ga0070678_1001417392 189
31 3300005458 Ga0070681_10032393 Ga0070681_100323934 189
32 3300005459 Ga0068867_100085404 Ga0068867_1000854042 189
33 3300005563 Ga0068855_100062150 Ga0068855_1000621502 189
34 3300005563 Ga0068855_100183849 Ga0068855_1001838493 189
35 3300005617 Ga0068859_100254380 Ga0068859_1002543801 189
36 3300005841 Ga0068863_100087152 Ga0068863_1000871522 189
37 3300005843 Ga0068860_100003333 Ga0068860_1000033333 189
38 3300005844 Ga0068862_100520448 Ga0068862_1005204482 189
39 3300006173 Ga0070716_100287925 Ga0070716_1002879252 189
40 3300006237 Ga0097621_100001109 Ga0097621_1000011096 189
41 3300006237 Ga0097621_101255205 Ga0097621_1012552051 189
42 3300006358 Ga0068871_100000569 Ga0068871_10000056914 189
43 3300006358 Ga0068871_100136043 Ga0068871_1001360432 189
44 3300006844 Ga0075428_100180980 Ga0075428_1001809802 189
45 3300006852 Ga0075433_11281511 Ga0075433_112815111 189
46 3300006881 Ga0068865_100140390 Ga0068865_1001403902 189
47 3300006881 Ga0068865_100359249 Ga0068865_1003592492 189
48 3300006931 Ga0097620_100254391 Ga0097620_1002543913 189
49 3300006946 Ga0079104_1000271 Ga0079104_100027111 189
50 3300006948 Ga0099826_10035924 Ga0099826_100359244 189
51 3300009011 Ga0105251_10065846 Ga0105251_100658463 189
52 3300009092 Ga0105250_10027433 Ga0105250_100274332 189
53 3300009093 Ga0105240_10132259 Ga0105240_101322594 189
54 3300009093 Ga0105240_11012282 Ga0105240_110122822 189
55 3300009174 Ga0105241_10442070 Ga0105241_104420702 189
56 3300009174 Ga0105241_11195043 Ga0105241_111950431 189
57 3300009177 Ga0105248_10378768 Ga0105248_103787681 189
58 3300009545 Ga0105237_10011468 Ga0105237_100114685 189
59 3300009545 Ga0105237_10095374 Ga0105237_100953742 189
60 3300009551 Ga0105238_10129965 Ga0105238_101299652 189
61 3300009551 Ga0105238_10835345 Ga0105238_108353451 189
62 3300010375 Ga0105239_10005273 Ga0105239_100052732 189
63 3300010375 Ga0105239_10207076 Ga0105239_102070763 189
64 3300011119 Ga0105246_10095467 Ga0105246_100954673 189
65 3300013102 Ga0157371_10002511 Ga0157371_100025117 189
66 3300013104 Ga0157370_10004393 Ga0157370_100043937 189
67 3300013104 Ga0157370_11056956 Ga0157370_110569562 189
68 3300013105 Ga0157369_10001133 Ga0157369_1000113336 189
69 3300013296 Ga0157374_10093609 Ga0157374_100936092 189
70 3300013296 Ga0157374_11366317 Ga0157374_113663171 189
71 3300013297 Ga0157378_10005099 Ga0157378_100050994 189
72 3300013297 Ga0157378_10007821 Ga0157378_100078218 189
73 3300013297 Ga0157378_10083975 Ga0157378_100839753 189
74 3300013297 Ga0157378_10277568 Ga0157378_102775683 189
75 3300013306 Ga0163162_10002445 Ga0163162_1000244515 189
76 3300013306 Ga0163162_10026402 Ga0163162_100264026 189
77 3300013307 Ga0157372_11446360 Ga0157372_114463602 189
78 3300013308 Ga0157375_10002218 Ga0157375_100022182 189
79 3300013308 Ga0157375_10434871 Ga0157375_104348712 189
80 3300014325 Ga0163163_10841563 Ga0163163_108415631 189
81 3300014326 Ga0157380_11488056 Ga0157380_114880562 189
82 3300014968 Ga0157379_10128403 Ga0157379_101284031 189
83 3300014968 Ga0157379_10232683 Ga0157379_102326832 189
84 3300014969 Ga0157376_10000665 Ga0157376_1000066518 189
85 3300014969 Ga0157376_10008493 Ga0157376_100084936 189
86 3300014969 Ga0157376_10057597 Ga0157376_100575973 189
87 3300014969 Ga0157376_10113543 Ga0157376_101135432 189
88 3300014969 Ga0157376_10250749 Ga0157376_102507492 189
89 3300015261 Ga0182006_1097617 Ga0182006_10976172 189
90 3300017792 Ga0163161_10001268 Ga0163161_1000126811 189
91 3300025903 Ga0207680_10236815 Ga0207680_102368152 189
92 3300025909 Ga0207705_10000031 Ga0207705_10000031156 189
93 3300025912 Ga0207707_10038124 Ga0207707_100381243 189
94 3300025913 Ga0207695_10220279 Ga0207695_102202792 189
95 3300025914 Ga0207671_10029775 Ga0207671_100297755 189
96 3300025914 Ga0207671_10054377 Ga0207671_100543772 189
97 3300025931 Ga0207644_10225780 Ga0207644_102257802 189
98 3300025938 Ga0207704_10443597 Ga0207704_104435972 189
99 3300025942 Ga0207689_10891864 Ga0207689_108918641 189
100 3300025949 Ga0207667_10018689 Ga0207667_100186893 189
101 3300025949 Ga0207667_10074684 Ga0207667_100746845 189
102 3300025986 Ga0207658_10008722 Ga0207658_100087227 189
103 3300025986 Ga0207658_10140749 Ga0207658_101407492 189
104 3300026023 Ga0207677_10533591 Ga0207677_105335912 189
105 3300026041 Ga0207639_10209105 Ga0207639_102091052 189
106 3300026041 Ga0207639_10920805 Ga0207639_109208052 189
107 3300026088 Ga0207641_10072977 Ga0207641_100729772 189
108 3300026088 Ga0207641_10663908 Ga0207641_106639082 189
109 3300026121 Ga0207683_10201498 Ga0207683_102014982 189
110 3300027111 Ga0209281_1000396 Ga0209281_10003969 189
111 3300027361 Ga0209489_113950 Ga0209489_1139504 189
112 3300028380 Ga0268265_10099573 Ga0268265_100995734 189
113 3300028381 Ga0268264_10021194 Ga0268264_100211943 189
114 3300028786 Ga0307517_10004393 Ga0307517_1000439320 189
115 3300031251 Ga0265327_10000248 Ga0265327_1000024871 189
116 3300031251 Ga0265327_10053499 Ga0265327_100534992 189
117 3300035115 Ga0373941_0011004 Ga0373941_0011004_252_824 189
118 3300035724 Ga0373933_0653587 Ga0373933_0653587_21_590 189
119 3300037418 Ga0395900_0019209 Ga0395900_0019209_4025_4609 189
120 3300037466 Ga0395898_0587696 Ga0395898_0587696_196_780 189
121 3300037471 Ga0395905_0001831 Ga0395905_0001831_23768_24352 189
122 3300038443 Ga0395901_0506818 Ga0395901_0506818_432_1016 189
123 3300041509 Ga0451843_0831380 Ga0451843_0831380_73_642 189
124 3300046453 Ga0495627_022521 Ga0495627_022521_493_1158 189
125 3300046453 Ga0495627_145110 Ga0495627_145110_11_580 189
126 3300046517 Ga0495630_0159942 Ga0495630_0159942_884_1528 189
127 3300046522 Ga0495643_0145843 Ga0495643_0145843_49_618 189
128 3300046533 Ga0495640_0268804 Ga0495640_0268804_307_951 189
129 3300046539 Ga0495621_0088985 Ga0495621_0088985_81_650 189
130 3300046558 Ga0495633_0000017 Ga0495633_0000017_166532_167110 189
131 3300046675 Ga0495657_0361543 Ga0495657_0361543_44_688 189
132 3300046683 Ga0495658_0060533 Ga0495658_0060533_907_1551 189
133 3300046692 Ga0495671_0138916 Ga0495671_0138916_290_859 189
134 3300047319 Ga0495674_0121742 Ga0495674_0121742_242_811 189
135 3300047321 Ga0495676_0193189 Ga0495676_0193189_669_1313 189
136 3300047322 Ga0495680_0046282 Ga0495680_0046282_2147_2716 189
137 3300047471 Ga0495684_0035626 Ga0495684_0035626_2398_2967 189
138 3300047472 Ga0495686_0207844 Ga0495686_0207844_52_624 189
139 3300048904 Ga0496101_0259401 Ga0496101_0259401_373_966 189
140 3300048917 Ga0496114_0058636 Ga0496114_0058636_828_1421 189
141 3300048918 Ga0496115_0083660 Ga0496115_0083660_653_1231 189
142 3300048920 Ga0496117_0060174 Ga0496117_0060174_907_1479 189
143 3300048927 Ga0496124_0157622 Ga0496124_0157622_348_920 189
144 3300048928 Ga0496125_0000026 Ga0496125_0000026_332416_332988 189
145 3300048929 Ga0496126_0005112 Ga0496126_0005112_8134_8706 189
146 3300048929 Ga0496126_0445959 Ga0496126_0445959_385_957 189
147 3300049679 Ga0501249_000003 Ga0501249_000003_161045_161614 189
148 3300053085 Ga0495619_0066704 Ga0495619_0066704_521_1090 189
149 3300053085 Ga0495619_0367972 Ga0495619_0367972_225_869 189
150 3300053090 Ga0500646_0008398 Ga0500646_0008398_1827_2396 189
151 3300053092 Ga0500583_0328821 Ga0500583_0328821_72_641 189
152 3300053093 Ga0500651_0100083 Ga0500651_0100083_108_686 189
153 3300053096 Ga0500641_0000030 Ga0500641_0000030_43911_44480 189
154 3300053146 Ga0500588_0004899 Ga0500588_0004899_1640_2218 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

38

213

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mcw-assembly1.cif.gz_B crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution 0.9613 1 188
3mcw-assembly1.cif.gz_B crystal structure of an a putative hydrolase of the isochorismatase family (cv_1320) from chromobacterium violaceum atcc 12472 at 1.06 a resolution 0.9366 1 188
4h17-assembly1.cif.gz_B crystal structure of an isochorismatase (pp1826) from pseudomonas putida kt2440 at 1.60 a resolution 0.9347 7 184
8cib-assembly1.cif.gz_F structural and functional analysis of the pseudomonas aeruginosa pa1677 protein 0.9303 7 185
2a67-assembly1.cif.gz_A crystal structure of isochorismatase family protein 0.9252 8 181
ID Description Score Start End Superfamily
3mcwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9586 1 188 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9335 8 187 3.40.50.850
4h17B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.931 7 184 3.40.50.850
af_B0G192_1_183_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9138 8 187 3.40.50.850
2a67C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9036 8 181 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2U1JUB6-F1-model_v4 Cysteine hydrolase 0.9957 1 189 GO:0016787
AF-A0A3M1YW21-F1-model_v4 Cysteine hydrolase 0.9909 43 187 GO:0016787
AF-A0A448LL80-F1-model_v4 deleted 0.9908 3 151
AF-A0A1I7FIS2-F1-model_v4 Nicotinamidase-related amidase 0.9901 1 187 GO:0016787
AF-A0A2E8N2D6-F1-model_v4 deleted 0.99 8 187

Feature Viewer

pLDDT pTM Quality
95.17 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map