F219773

General Info

Members Datasets Scaffolds Average Seq Length
154 112 308 143

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10256147|Ga0207643_102561472
Length 164
Sequence MSTHTHLHTPAILGRSATGSSRGAHEAFLLLRTVFTIAPIAFGLDKFAEVLTDNWEGYLAPWVNDIVPGTAHQAMLAVGVIEIIAGIAVAVVPRYGALLVVGWLAGIIVNLVSIGDFYDIALRDFGLLVAALALAILAANRGKAPGFTTIRNALADVTRDSGQK

Samples

Sample ID Description Type Environment
1 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
15 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
54 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
67 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
73 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
74 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
78 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
81 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
88 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
89 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
90 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
102 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
103 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
104 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
105 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
109 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
110 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
111 2643221641 Nocardioides sp. Root122 Isolate Unclassified
112 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 1.3
Isolates 1.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.9
Nodule 0
Rhizoplane 5.84
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207643_10256147 3300025908 Bacteria 1079
2 Ga0006778J45830_1050231 3300003162 Bacteria 510
3 Ga0006777J48905_1025785 3300003308 Bacteria 526
4 JGI25407J50210_10060293 3300003373 Bacteria 954
5 Ga0070683_100285217 3300005329 Bacteria 1571
6 Ga0070683_100331809 3300005329 Bacteria 1448
7 Ga0070683_100563569 3300005329 Bacteria 1089
8 Ga0070683_100712748 3300005329 Bacteria 961
9 Ga0070682_100120146 3300005337 Bacteria 1763
10 Ga0070682_101758815 3300005337 Bacteria 540
11 Ga0068868_101393270 3300005338 Bacteria 654
12 Ga0068868_101506544 3300005338 Bacteria 630
13 Ga0068868_101934124 3300005338 Bacteria 559
14 Ga0070691_10784061 3300005341 Bacteria 579
15 Ga0070674_101547350 3300005356 Bacteria 597
16 Ga0070659_102090605 3300005366 Bacteria 509
17 Ga0068857_100866074 3300005577 Bacteria 865
18 Ga0068856_100078714 3300005614 Bacteria 3268
19 Ga0068852_102328812 3300005616 Bacteria 556
20 Ga0068861_101083126 3300005719 Bacteria 769
21 Ga0068870_10255942 3300005840 Bacteria 1087
22 Ga0081455_10000352 3300005937 Bacteria 60576
23 Ga0081455_10004834 3300005937 Bacteria 14954
24 Ga0081538_10000417 3300005981 Bacteria 47830
25 Ga0075363_101046703 3300006048 Bacteria 504
26 Ga0075364_10255888 3300006051 Bacteria 1190
27 Ga0075370_10604989 3300006353 Bacteria 664
28 Ga0068871_101484362 3300006358 Bacteria 640
29 Ga0075428_100004037 3300006844 Bacteria 16128
30 Ga0075428_100764687 3300006844 Bacteria 1028
31 Ga0075430_100007755 3300006846 Bacteria 9070
32 Ga0075431_100001137 3300006847 Bacteria 23885
33 Ga0075433_10044829 3300006852 Bacteria 3843
34 Ga0075429_100018806 3300006880 Bacteria 5984
35 Ga0111539_10003895 3300009094 Bacteria 19625
36 Ga0111539_10815957 3300009094 Bacteria 1085
37 Ga0105245_10972439 3300009098 Bacteria 893
38 Ga0114129_10068731 3300009147 Bacteria 4939
39 Ga0114129_10113241 3300009147 Bacteria 3741
40 Ga0105243_11126601 3300009148 Bacteria 794
41 Ga0105238_10085543 3300009551 Bacteria 3141
42 Ga0105238_10290836 3300009551 Bacteria 1616
43 Ga0105239_11093336 3300010375 Bacteria 918
44 Ga0105246_10514553 3300011119 Bacteria 1019
45 Ga0157371_10222685 3300013102 Bacteria 1355
46 Ga0157371_10690059 3300013102 Bacteria 764
47 Ga0157369_10016861 3300013105 Bacteria 8207
48 Ga0157369_10083241 3300013105 Bacteria 3422
49 Ga0157374_11414663 3300013296 Bacteria 718
50 Ga0157372_10166167 3300013307 Bacteria 2552
51 Ga0157372_10600614 3300013307 Bacteria 1283
52 Ga0157375_12438607 3300013308 Bacteria 624
53 Ga0207643_10058765 3300025908 Bacteria 2193
54 Ga0207690_10213395 3300025932 Bacteria 1473
55 Ga0207709_10521460 3300025935 Bacteria 930
56 Ga0207709_10974712 3300025935 Bacteria 692
57 Ga0207704_10906546 3300025938 Bacteria 742
58 Ga0207689_10476148 3300025942 Bacteria 1045
59 Ga0207661_10340210 3300025944 Bacteria 1352
60 Ga0207661_10493564 3300025944 Bacteria 1118
61 Ga0207667_11885499 3300025949 Bacteria 560
62 Ga0207677_10201983 3300026023 Bacteria 1580
63 Ga0207702_10058013 3300026078 Bacteria 3293
64 Ga0207641_11552645 3300026088 Bacteria 664
65 Ga0207675_100803468 3300026118 Bacteria 954
66 Ga0207675_100805979 3300026118 Bacteria 952
67 Ga0207683_10713856 3300026121 Bacteria 930
68 Ga0207428_10008824 3300027907 Bacteria 9089
69 Ga0268265_10135181 3300028380 Bacteria 2056
70 Ga0268264_11049577 3300028381 Bacteria 822
71 Ga0316181_1044856 3300030744 Bacteria 1472
72 Ga0307513_10094231 3300031456 Bacteria 3040
73 Ga0307405_10444739 3300031731 Bacteria 1026
74 Ga0307410_10221980 3300031852 Bacteria 1454
75 Ga0307410_10589233 3300031852 Bacteria 926
76 Ga0307410_11258612 3300031852 Bacteria 646
77 Ga0307406_10491197 3300031901 Bacteria 993
78 Ga0307409_100134473 3300031995 Bacteria 2119
79 Ga0307409_101253626 3300031995 Bacteria 766
80 Ga0307409_102209511 3300031995 Bacteria 580
81 Ga0307414_10700058 3300032004 Bacteria 917
82 Ga0307415_100888478 3300032126 Bacteria 820
83 Ga0307415_101463853 3300032126 Bacteria 652
84 Ga0395899_0139266 3300037312 Bacteria 1728
85 Ga0395900_0238052 3300037418 Bacteria 1827
86 Ga0395900_1115643 3300037418 Bacteria 706
87 Ga0395898_0418057 3300037466 Bacteria 1278
88 Ga0395905_0142094 3300037471 Bacteria 2258
89 Ga0395905_0179722 3300037471 Bacteria 1986
90 Ga0395901_0097619 3300038443 Bacteria 3080
91 Ga0451797_1507692 3300041453 Bacteria 1021
92 Ga0466966_0078050 3300044684 Bacteria 2066
93 Ga0466963_0537103 3300044694 Bacteria 826
94 Ga0466960_0045976 3300044901 Bacteria 2088
95 Ga0466960_0136984 3300044901 Bacteria 1297
96 Ga0466958_0094111 3300045836 Bacteria 1856
97 Ga0466958_0884155 3300045836 Bacteria 583
98 Ga0466967_0060902 3300045976 Bacteria 3347
99 Ga0495645_0575550 3300046543 Unclassified 695
100 Ga0496102_1023821 3300048905 Bacteria 746
101 Ga0496107_0161931 3300048910 Bacteria 1658
102 Ga0496107_1160292 3300048910 Bacteria 556
103 Ga0496108_0533016 3300048911 Bacteria 1025
104 Ga0496109_0369119 3300048912 Bacteria 1356
105 Ga0496109_0463210 3300048912 Bacteria 1197
106 Ga0496109_0751033 3300048912 Bacteria 913
107 Ga0496114_0418491 3300048917 Bacteria 1187
108 Ga0501031_0199922 3300049568 Bacteria 1304
109 Ga0501033_0952305 3300049570 Bacteria 575
110 Ga0501034_0282273 3300049571 Bacteria 1600
111 Ga0501036_0120333 3300049572 Bacteria 2217
112 Ga0501036_0172748 3300049572 Bacteria 1821
113 Ga0501038_0703866 3300049574 Bacteria 757
114 Ga0501039_0102518 3300049575 Bacteria 2234
115 Ga0501039_0262131 3300049575 Bacteria 1358
116 Ga0501039_0666614 3300049575 Bacteria 814
117 Ga0501040_0635626 3300049576 Bacteria 771
118 Ga0501041_0079971 3300049577 Bacteria 2012
119 Ga0501041_0314775 3300049577 Bacteria 987
120 Ga0501042_0037507 3300049578 Bacteria 3440
121 Ga0501042_0100210 3300049578 Bacteria 2083
122 Ga0501067_0780511 3300049583 Bacteria 538
123 Ga0501068_0616082 3300049584 Bacteria 708
124 Ga0501070_0022417 3300049586 Bacteria 5289
125 Ga0501071_0910189 3300049587 Bacteria 679
126 Ga0501072_0113798 3300049588 Bacteria 2154
127 Ga0501072_0239584 3300049588 Bacteria 1445
128 Ga0501072_1110179 3300049588 Bacteria 615
129 Ga0501075_0081077 3300049591 Bacteria 2456
130 Ga0501077_0108135 3300049593 Bacteria 1762
131 Ga0501079_0358503 3300049741 Bacteria 1143
132 Ga0501080_0677825 3300049742 Bacteria 911
133 Ga0501080_1011515 3300049742 Bacteria 720
134 Ga0501081_0156354 3300049743 Bacteria 1641
135 Ga0501081_0407764 3300049743 Bacteria 1007
136 Ga0501081_0723739 3300049743 Bacteria 747
137 Ga0501081_0901021 3300049743 Bacteria 667
138 Ga0501035_1541587 3300049822 Bacteria 506
139 Ga0501045_0028673 3300049824 Bacteria 4017
140 nmdc:mga03n38_439255_c1 3300050490 Bacteria 724
141 nmdc:mga06z11_394599_c1 3300050494 Bacteria 832
142 nmdc:mga05p37_573_c1 3300050507 Bacteria 40363
143 nmdc:mga05p37_760609_c1 3300050507 Bacteria 1066
144 nmdc:mga09592_227_c1 3300050508 Bacteria 40641
145 nmdc:mga0qj67_20744_c1 3300050509 Bacteria 5033
146 nmdc:mga06r32_83_c1 3300050510 Bacteria 64174
147 nmdc:mga08y16_15450_c1 3300050511 Bacteria 8029
148 nmdc:mga0n895_107880_c1 3300050512 Bacteria 2798
149 nmdc:mga0a205_36617_c1 3300050515 Bacteria 4715
150 Ga0500644_0451465 3300053088 Bacteria 563
151 Ga0530510_0270360 3300061734 Bacteria 1268
152 2623498457 2622736605 Bacteria 4992138
153 2644230508 2643221641 Bacteria 4490190
154 2946036474 2946033335 Bacteria 3835514
155 Ga0207643_10256147
156 Ga0006778J45830_1050231
157 Ga0006777J48905_1025785
158 JGI25407J50210_10060293
159 Ga0070683_100285217
160 Ga0070683_100331809
161 Ga0070683_100563569
162 Ga0070683_100712748
163 Ga0070682_100120146
164 Ga0070682_101758815
165 Ga0068868_101393270
166 Ga0068868_101506544
167 Ga0068868_101934124
168 Ga0070691_10784061
169 Ga0070674_101547350
170 Ga0070659_102090605
171 Ga0068857_100866074
172 Ga0068856_100078714
173 Ga0068852_102328812
174 Ga0068861_101083126
175 Ga0068870_10255942
176 Ga0081455_10000352
177 Ga0081455_10004834
178 Ga0081538_10000417
179 Ga0075363_101046703
180 Ga0075364_10255888
181 Ga0075370_10604989
182 Ga0068871_101484362
183 Ga0075428_100004037
184 Ga0075428_100764687
185 Ga0075430_100007755
186 Ga0075431_100001137
187 Ga0075433_10044829
188 Ga0075429_100018806
189 Ga0111539_10003895
190 Ga0111539_10815957
191 Ga0105245_10972439
192 Ga0114129_10068731
193 Ga0114129_10113241
194 Ga0105243_11126601
195 Ga0105238_10085543
196 Ga0105238_10290836
197 Ga0105239_11093336
198 Ga0105246_10514553
199 Ga0157371_10222685
200 Ga0157371_10690059
201 Ga0157369_10016861
202 Ga0157369_10083241
203 Ga0157374_11414663
204 Ga0157372_10166167
205 Ga0157372_10600614
206 Ga0157375_12438607
207 Ga0207643_10058765
208 Ga0207690_10213395
209 Ga0207709_10521460
210 Ga0207709_10974712
211 Ga0207704_10906546
212 Ga0207689_10476148
213 Ga0207661_10340210
214 Ga0207661_10493564
215 Ga0207667_11885499
216 Ga0207677_10201983
217 Ga0207702_10058013
218 Ga0207641_11552645
219 Ga0207675_100803468
220 Ga0207675_100805979
221 Ga0207683_10713856
222 Ga0207428_10008824
223 Ga0268265_10135181
224 Ga0268264_11049577
225 Ga0316181_1044856
226 Ga0307513_10094231
227 Ga0307405_10444739
228 Ga0307410_10221980
229 Ga0307410_10589233
230 Ga0307410_11258612
231 Ga0307406_10491197
232 Ga0307409_100134473
233 Ga0307409_101253626
234 Ga0307409_102209511
235 Ga0307414_10700058
236 Ga0307415_100888478
237 Ga0307415_101463853
238 Ga0395899_0139266
239 Ga0395900_0238052
240 Ga0395900_1115643
241 Ga0395898_0418057
242 Ga0395905_0142094
243 Ga0395905_0179722
244 Ga0395901_0097619
245 Ga0451797_1507692
246 Ga0466966_0078050
247 Ga0466963_0537103
248 Ga0466960_0045976
249 Ga0466960_0136984
250 Ga0466958_0094111
251 Ga0466958_0884155
252 Ga0466967_0060902
253 Ga0495645_0575550
254 Ga0496102_1023821
255 Ga0496107_0161931
256 Ga0496107_1160292
257 Ga0496108_0533016
258 Ga0496109_0369119
259 Ga0496109_0463210
260 Ga0496109_0751033
261 Ga0496114_0418491
262 Ga0501031_0199922
263 Ga0501033_0952305
264 Ga0501034_0282273
265 Ga0501036_0120333
266 Ga0501036_0172748
267 Ga0501038_0703866
268 Ga0501039_0102518
269 Ga0501039_0262131
270 Ga0501039_0666614
271 Ga0501040_0635626
272 Ga0501041_0079971
273 Ga0501041_0314775
274 Ga0501042_0037507
275 Ga0501042_0100210
276 Ga0501067_0780511
277 Ga0501068_0616082
278 Ga0501070_0022417
279 Ga0501071_0910189
280 Ga0501072_0113798
281 Ga0501072_0239584
282 Ga0501072_1110179
283 Ga0501075_0081077
284 Ga0501077_0108135
285 Ga0501079_0358503
286 Ga0501080_0677825
287 Ga0501080_1011515
288 Ga0501081_0156354
289 Ga0501081_0407764
290 Ga0501081_0723739
291 Ga0501081_0901021
292 Ga0501035_1541587
293 Ga0501045_0028673
294 nmdc:mga03n38_439255_c1
295 nmdc:mga06z11_394599_c1
296 nmdc:mga05p37_573_c1
297 nmdc:mga05p37_760609_c1
298 nmdc:mga09592_227_c1
299 nmdc:mga0qj67_20744_c1
300 nmdc:mga06r32_83_c1
301 nmdc:mga08y16_15450_c1
302 nmdc:mga0n895_107880_c1
303 nmdc:mga0a205_36617_c1
304 Ga0500644_0451465
305 Ga0530510_0270360
306 2623498457
307 2644230508
308 2946036474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.5766 2 105
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.5556 2 105
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.5219 3 107
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.5044 3 107
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.4329 6 109
ID Description Score Start End Superfamily
af_Q8NCS4_7_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8145 1 103 1.20.120.550
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7763 1 102 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7416 2 112 1.10.10.1740
af_Q53FP2_11_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7302 1 102 1.20.120.550
af_Q8NCS4_7_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7205 1 103 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A1G9EKX6-F1-model_v4 DoxX protein 0.9974 2 107 GO:0016020
AF-A0A3D9STS6-F1-model_v4 DoxX-like protein 0.9966 2 109 GO:0016020
AF-A0A538FSD1-F1-model_v4 DoxX family membrane protein 0.9963 1 112 GO:0016020
AF-A0A563EM74-F1-model_v4 DoxX family membrane protein 0.9962 2 109 GO:0016020
AF-A0A4Q4Z9F4-F1-model_v4 DoxX family membrane protein 0.9958 2 108 GO:0016020

Map