F219059

General Info

Members Datasets Scaffolds Average Seq Length
154 71 308 320

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100252772|Ga0070706_1002527722
Length 357
Sequence MNRRSLLGIVASGNYCRVSPRAEVSRRAFVTGFAATLVVSFGTQAQSQGKVYRVGYLAQGSAPTTPNPIFEAFRQQLRELGYIEGQNMIIEYRYAEGRSERLPDLAAELVRLKVDVIVAGGTPAPLAAKHATGTIPIVMAAAGDPLGTGLVTNLAKPEGNITGLSNESIDLTAKRLQLLKEILPRLSRVAVLWNAANVVAVTHMRETEAAARTLGLQLQSLEVRSPDDFENARLERRLLDVIRVDGGAGALFLIDDPLVFRYHSQVADFAARNRLPATAIYKQFAAAGGLMTFGANLTDLYRRAAIFVDRILKGAKPADLPIEQPTKFELVINLKTAKALGLTIPRSLLQRADQVIE

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
37 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
38 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
39 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
40 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
43 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
44 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
45 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
46 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
47 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
48 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
49 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
50 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
51 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
52 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
53 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
54 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
55 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
56 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
57 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
58 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
59 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
60 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
61 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
62 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
63 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
64 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
65 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
66 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
67 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
68 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
69 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
70 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
71 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.35
Metatranscriptomes 0
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.65
Rhizoplane 0.65
Rhizosphere 96.75
Stem 0
Stem Tuber 0
Unclassified 14.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100252772 3300005467 Bacteria 1645
2 JGI25405J52794_10006666 3300003911 Bacteria 2113
3 Ga0065707_10096362 3300005295 Bacteria 3277
4 Ga0068869_100269715 3300005334 Bacteria 1365
5 Ga0070666_10048442 3300005335 Bacteria 2855
6 Ga0070688_100074710 3300005365 Unclassified 2177
7 Ga0070694_100015899 3300005444 Bacteria 4735
8 Ga0070708_100043900 3300005445 Bacteria 3929
9 Ga0070706_100114993 3300005467 Unclassified 2505
10 Ga0070706_100151100 3300005467 Unclassified 2168
11 Ga0070706_100194364 3300005467 Bacteria 1896
12 Ga0070706_100326555 3300005467 Bacteria 1431
13 Ga0070706_100348726 3300005467 Bacteria 1380
14 Ga0070707_100069509 3300005468 Unclassified 3390
15 Ga0070707_100098154 3300005468 Bacteria 2837
16 Ga0070707_100176185 3300005468 Bacteria 2084
17 Ga0070707_100383332 3300005468 Bacteria 1365
18 Ga0070698_100093787 3300005471 Bacteria 2981
19 Ga0070698_100175499 3300005471 Bacteria 2082
20 Ga0070698_100305521 3300005471 Bacteria 1521
21 Ga0070698_100528160 3300005471 Bacteria 1118
22 Ga0070699_100007519 3300005518 Bacteria 9477
23 Ga0070699_100008511 3300005518 Bacteria 8893
24 Ga0070699_100053635 3300005518 Bacteria 3489
25 Ga0070699_100081065 3300005518 Bacteria 2828
26 Ga0070699_100177050 3300005518 Unclassified 1892
27 Ga0070697_100006249 3300005536 Bacteria 9221
28 Ga0070697_100012739 3300005536 Bacteria 6585
29 Ga0070697_100021664 3300005536 Bacteria 5094
30 Ga0070695_100004417 3300005545 Bacteria 8252
31 Ga0068852_100168268 3300005616 Bacteria 2052
32 Ga0068859_100123975 3300005617 Bacteria 2651
33 Ga0068864_100606102 3300005618 Bacteria 1063
34 Ga0081455_10000084 3300005937 Bacteria 101753
35 Ga0081455_10015080 3300005937 Bacteria 7523
36 Ga0081455_10019131 3300005937 Bacteria 6490
37 Ga0081455_10023724 3300005937 Bacteria 5702
38 Ga0081455_10056196 3300005937 Bacteria 3344
39 Ga0081455_10103990 3300005937 Bacteria 2273
40 Ga0081538_10017044 3300005981 Bacteria 5536
41 Ga0081540_1006813 3300005983 Bacteria 8256
42 Ga0081540_1036653 3300005983 Bacteria 2611
43 Ga0070717_10494919 3300006028 Bacteria 1104
44 Ga0070712_100377989 3300006175 Bacteria 1165
45 Ga0075428_100036363 3300006844 Bacteria 5423
46 Ga0075428_100096794 3300006844 Bacteria 3217
47 Ga0075428_100101953 3300006844 Bacteria 3129
48 Ga0075428_100249471 3300006844 Bacteria 1913
49 Ga0075428_100252018 3300006844 Bacteria 1902
50 Ga0075428_100405703 3300006844 Bacteria 1460
51 Ga0075430_100033415 3300006846 Bacteria 4365
52 Ga0075430_100056268 3300006846 Unclassified 3307
53 Ga0075430_100422953 3300006846 Bacteria 1099
54 Ga0075431_100034416 3300006847 Bacteria 5219
55 Ga0075431_100123673 3300006847 Bacteria 2669
56 Ga0075431_100198686 3300006847 Bacteria 2052
57 Ga0075433_10260144 3300006852 Bacteria 1539
58 Ga0075433_10285611 3300006852 Bacteria 1461
59 Ga0075434_100106522 3300006871 Bacteria 2813
60 Ga0075434_100290617 3300006871 Bacteria 1655
61 Ga0075434_100341460 3300006871 Bacteria 1518
62 Ga0075429_100075647 3300006880 Bacteria 2933
63 Ga0075429_100223198 3300006880 Bacteria 1650
64 Ga0075429_100345495 3300006880 Bacteria 1302
65 Ga0075436_100172218 3300006914 Bacteria 1528
66 Ga0097620_100123981 3300006931 Bacteria 2651
67 Ga0114129_10098363 3300009147 Bacteria 4050
68 Ga0114129_10099346 3300009147 Bacteria 4028
69 Ga0114129_10214745 3300009147 Unclassified 2598
70 Ga0114129_10484515 3300009147 Bacteria 1618
71 Ga0114129_10571908 3300009147 Bacteria 1467
72 Ga0114129_10597261 3300009147 Unclassified 1430
73 Ga0114129_10729234 3300009147 Bacteria 1271
74 Ga0114129_10751693 3300009147 Bacteria 1248
75 Ga0163162_10352498 3300013306 Bacteria 1604
76 Ga0163162_10639939 3300013306 Bacteria 1188
77 Ga0163163_10648248 3300014325 Bacteria 1119
78 Ga0207684_10002447 3300025910 Bacteria 18730
79 Ga0207684_10017739 3300025910 Bacteria 6106
80 Ga0207684_10132799 3300025910 Unclassified 2137
81 Ga0207693_10101802 3300025915 Bacteria 2252
82 Ga0207693_10146096 3300025915 Bacteria 1860
83 Ga0207646_10048890 3300025922 Unclassified 3790
84 Ga0207646_10062087 3300025922 Bacteria 3336
85 Ga0373936_0018958 3300035113 Bacteria 2663
86 Ga0373943_0315582 3300035170 Bacteria 890
87 Ga0373931_0013147 3300035691 Bacteria 4026
88 Ga0373937_0003449 3300036401 Bacteria 13276
89 Ga0373925_0620938 3300037068 Bacteria 890
90 Ga0436364_1260149 3300037853 Bacteria 1006
91 Ga0395901_0107054 3300038443 Bacteria 2935
92 Ga0436365_0921348 3300039437 Bacteria 3269
93 Ga0436363_0323338 3300039450 Bacteria 1702
94 Ga0453683_0114772 3300044673 Bacteria 1694
95 Ga0453684_0243533 3300044712 Bacteria 2069
96 Ga0451576_0042884 3300045051 Bacteria 4776
97 Ga0495641_0197295 3300046461 Unclassified 902
98 Ga0495582_0059287 3300046473 Bacteria 2112
99 Ga0495607_0143988 3300046501 Bacteria 1227
100 Ga0495624_0192848 3300046690 Unclassified 1239
101 Ga0496115_0047079 3300048918 Bacteria 3448
102 Ga0501039_0242945 3300049575 Unclassified 1416
103 Ga0501068_0296087 3300049584 Bacteria 1035
104 Ga0501071_0447808 3300049587 Bacteria 988
105 Ga0501072_0195034 3300049588 Bacteria 1615
106 Ga0501072_0406930 3300049588 Bacteria 1079
107 Ga0501075_0037407 3300049591 Unclassified 3626
108 Ga0501076_0121478 3300049592 Unclassified 2115
109 Ga0501076_0220549 3300049592 Bacteria 1550
110 Ga0501077_0104537 3300049593 Bacteria 1794
111 Ga0501081_0204092 3300049743 Unclassified 1434
112 nmdc:mga05p37_1040657_c1 3300050507 Bacteria 865
113 nmdc:mga05p37_135787_c1 3300050507 Bacteria 3017
114 nmdc:mga05p37_142657_c1 3300050507 Bacteria 2934
115 nmdc:mga05p37_172449_c1 3300050507 Bacteria 2638
116 nmdc:mga05p37_268160_c1 3300050507 Bacteria 2041
117 nmdc:mga05p37_2804_c2 3300050507 Bacteria 13478
118 nmdc:mga05p37_288162_c1 3300050507 Unclassified 1955
119 nmdc:mga05p37_436100_c1 3300050507 Bacteria 1521
120 nmdc:mga05p37_463568_c1 3300050507 Unclassified 1464
121 nmdc:mga05p37_5275_c1 3300050507 Bacteria 15168
122 nmdc:mga05p37_561630_c1 3300050507 Unclassified 1297
123 nmdc:mga05p37_586919_c1 3300050507 Bacteria 1261
124 nmdc:mga05p37_60726_c1 3300050507 Bacteria 4654
125 nmdc:mga09592_10488_c1 3300050508 Bacteria 7541
126 nmdc:mga09592_21601_c1 3300050508 Bacteria 5306
127 nmdc:mga09592_33337_c1 3300050508 Bacteria 4298
128 nmdc:mga09592_4404_c1 3300050508 Bacteria 11391
129 nmdc:mga09592_90262_c1 3300050508 Bacteria 2618
130 nmdc:mga0qj67_2250_c1 3300050509 Bacteria 13724
131 nmdc:mga0qj67_358679_c1 3300050509 Bacteria 1178
132 nmdc:mga06r32_138828_c1 3300050510 Bacteria 2406
133 nmdc:mga06r32_14170_c1 3300050510 Bacteria 7231
134 nmdc:mga06r32_158028_c1 3300050510 Bacteria 2249
135 nmdc:mga06r32_54989_c1 3300050510 Bacteria 3818
136 nmdc:mga06r32_631944_c1 3300050510 Bacteria 1040
137 nmdc:mga06r32_70716_c1 3300050510 Bacteria 3376
138 nmdc:mga08y16_530866_c1 3300050511 Bacteria 1193
139 nmdc:mga0n895_154683_c1 3300050512 Bacteria 2324
140 nmdc:mga0n895_4263_c1 3300050512 Bacteria 11701
141 nmdc:mga0n895_7050_c1 3300050512 Bacteria 9601
142 nmdc:mga0n895_89284_c1 3300050512 Bacteria 3083
143 nmdc:mga0n895_98909_c1 3300050512 Bacteria 2925
144 nmdc:mga0rr50_76346_c1 3300050513 Bacteria 2572
145 nmdc:mga0a205_127210_c1 3300050515 Bacteria 2448
146 nmdc:mga0a205_17860_c1 3300050515 Bacteria 6657
147 nmdc:mga0a205_186530_c1 3300050515 Unclassified 1967
148 nmdc:mga0a205_256083_c1 3300050515 Bacteria 1629
149 nmdc:mga0a205_303344_c1 3300050515 Bacteria 1470
150 nmdc:mga0a205_316708_c1 3300050515 Unclassified 1431
151 Ga0495601_0119230 3300053077 Unclassified 1713
152 Ga0530510_0031902 3300061734 Bacteria 3789
153 Ga0530510_0170203 3300061734 Unclassified 1613
154 8006966962 8006964411 Bacteria 8966052
155 Ga0070706_100252772
156 JGI25405J52794_10006666
157 Ga0065707_10096362
158 Ga0068869_100269715
159 Ga0070666_10048442
160 Ga0070688_100074710
161 Ga0070694_100015899
162 Ga0070708_100043900
163 Ga0070706_100114993
164 Ga0070706_100151100
165 Ga0070706_100194364
166 Ga0070706_100326555
167 Ga0070706_100348726
168 Ga0070707_100069509
169 Ga0070707_100098154
170 Ga0070707_100176185
171 Ga0070707_100383332
172 Ga0070698_100093787
173 Ga0070698_100175499
174 Ga0070698_100305521
175 Ga0070698_100528160
176 Ga0070699_100007519
177 Ga0070699_100008511
178 Ga0070699_100053635
179 Ga0070699_100081065
180 Ga0070699_100177050
181 Ga0070697_100006249
182 Ga0070697_100012739
183 Ga0070697_100021664
184 Ga0070695_100004417
185 Ga0068852_100168268
186 Ga0068859_100123975
187 Ga0068864_100606102
188 Ga0081455_10000084
189 Ga0081455_10015080
190 Ga0081455_10019131
191 Ga0081455_10023724
192 Ga0081455_10056196
193 Ga0081455_10103990
194 Ga0081538_10017044
195 Ga0081540_1006813
196 Ga0081540_1036653
197 Ga0070717_10494919
198 Ga0070712_100377989
199 Ga0075428_100036363
200 Ga0075428_100096794
201 Ga0075428_100101953
202 Ga0075428_100249471
203 Ga0075428_100252018
204 Ga0075428_100405703
205 Ga0075430_100033415
206 Ga0075430_100056268
207 Ga0075430_100422953
208 Ga0075431_100034416
209 Ga0075431_100123673
210 Ga0075431_100198686
211 Ga0075433_10260144
212 Ga0075433_10285611
213 Ga0075434_100106522
214 Ga0075434_100290617
215 Ga0075434_100341460
216 Ga0075429_100075647
217 Ga0075429_100223198
218 Ga0075429_100345495
219 Ga0075436_100172218
220 Ga0097620_100123981
221 Ga0114129_10098363
222 Ga0114129_10099346
223 Ga0114129_10214745
224 Ga0114129_10484515
225 Ga0114129_10571908
226 Ga0114129_10597261
227 Ga0114129_10729234
228 Ga0114129_10751693
229 Ga0163162_10352498
230 Ga0163162_10639939
231 Ga0163163_10648248
232 Ga0207684_10002447
233 Ga0207684_10017739
234 Ga0207684_10132799
235 Ga0207693_10101802
236 Ga0207693_10146096
237 Ga0207646_10048890
238 Ga0207646_10062087
239 Ga0373936_0018958
240 Ga0373943_0315582
241 Ga0373931_0013147
242 Ga0373937_0003449
243 Ga0373925_0620938
244 Ga0436364_1260149
245 Ga0395901_0107054
246 Ga0436365_0921348
247 Ga0436363_0323338
248 Ga0453683_0114772
249 Ga0453684_0243533
250 Ga0451576_0042884
251 Ga0495641_0197295
252 Ga0495582_0059287
253 Ga0495607_0143988
254 Ga0495624_0192848
255 Ga0496115_0047079
256 Ga0501039_0242945
257 Ga0501068_0296087
258 Ga0501071_0447808
259 Ga0501072_0195034
260 Ga0501072_0406930
261 Ga0501075_0037407
262 Ga0501076_0121478
263 Ga0501076_0220549
264 Ga0501077_0104537
265 Ga0501081_0204092
266 nmdc:mga05p37_1040657_c1
267 nmdc:mga05p37_135787_c1
268 nmdc:mga05p37_142657_c1
269 nmdc:mga05p37_172449_c1
270 nmdc:mga05p37_268160_c1
271 nmdc:mga05p37_2804_c2
272 nmdc:mga05p37_288162_c1
273 nmdc:mga05p37_436100_c1
274 nmdc:mga05p37_463568_c1
275 nmdc:mga05p37_5275_c1
276 nmdc:mga05p37_561630_c1
277 nmdc:mga05p37_586919_c1
278 nmdc:mga05p37_60726_c1
279 nmdc:mga09592_10488_c1
280 nmdc:mga09592_21601_c1
281 nmdc:mga09592_33337_c1
282 nmdc:mga09592_4404_c1
283 nmdc:mga09592_90262_c1
284 nmdc:mga0qj67_2250_c1
285 nmdc:mga0qj67_358679_c1
286 nmdc:mga06r32_138828_c1
287 nmdc:mga06r32_14170_c1
288 nmdc:mga06r32_158028_c1
289 nmdc:mga06r32_54989_c1
290 nmdc:mga06r32_631944_c1
291 nmdc:mga06r32_70716_c1
292 nmdc:mga08y16_530866_c1
293 nmdc:mga0n895_154683_c1
294 nmdc:mga0n895_4263_c1
295 nmdc:mga0n895_7050_c1
296 nmdc:mga0n895_89284_c1
297 nmdc:mga0n895_98909_c1
298 nmdc:mga0rr50_76346_c1
299 nmdc:mga0a205_127210_c1
300 nmdc:mga0a205_17860_c1
301 nmdc:mga0a205_186530_c1
302 nmdc:mga0a205_256083_c1
303 nmdc:mga0a205_303344_c1
304 nmdc:mga0a205_316708_c1
305 Ga0495601_0119230
306 Ga0530510_0031902
307 Ga0530510_0170203
308 8006966962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

66

356

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9256 39 335
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9195 39 335
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9036 41 336
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8948 41 336
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8895 43 336
ID Description Score Start End Superfamily
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8956 158 335 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8804 43 307 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8748 158 336 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8723 158 335 3.40.50.2300
3lftB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8684 43 307 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A534TVN5-F1-model_v4 ABC transporter substrate-binding protein 0.9718 237 337
AF-A0A1G8R933-F1-model_v4 Putative ABC transport system substrate-binding protein 0.9706 191 337
AF-A0A536ZNV9-F1-model_v4 ABC transporter substrate-binding protein 0.9703 227 337
AF-A0A537P9Y2-F1-model_v4 ABC transporter substrate-binding protein 0.9699 202 337
AF-A0A7V9HTZ8-F1-model_v4 ABC transporter substrate-binding protein 0.9687 232 337

Map