F218866

General Info

Members Datasets Scaffolds Average Seq Length
154 114 308 329

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100070048|Ga0070668_1000700482
Length 361
Sequence VRPLLTGLSVTSYNRAVCQRHPGACFLKTAVSKRAIITGITGQDGSYLAELLLSKGYEVVGVVRRASAPNYWRIQHLLDRVTLRNADLLDQLSLIRLVEEVRPHEFYNLAAMSFVPASWDQPMLTGEFNAQGVTRVLEAIRQVDTSIRLYQASSSEMFGKVREVPQTEMTPFYPRSPYGVSKVFAHYITVNYRESYDMFAVSGILFNHESPRRGLEFVTRKVTDAVARIKLGLTKTLSLGNLDAHRDWGFAGDYVAAMHLMLQKDQADDYVIATGISHSVRDLVQAAFGHVGLDWQKHVELDPKLIRPAEVEHLIGDSAKAQAQLGWKPLVDFGSLVKMMVDADLERAAAAPQLVDRLSTL

Samples

Sample ID Description Type Environment
1 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
81 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
86 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
92 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
93 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
98 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
107 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
108 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
109 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
110 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
112 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 0.65
Rhizosphere 96.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070668_100070048 3300005347 Bacteria 2730
2 Ga0065712_10192220 3300005290 Bacteria 1143
3 Ga0065715_10158702 3300005293 Bacteria 1649
4 Ga0070658_10297489 3300005327 Bacteria 1376
5 Ga0070690_100048619 3300005330 Bacteria 2701
6 Ga0070670_100010776 3300005331 Bacteria 7809
7 Ga0070660_100029200 3300005339 Bacteria 4130
8 Ga0070689_100147808 3300005340 Bacteria 1894
9 Ga0070669_100096153 3300005353 Bacteria 2228
10 Ga0070674_100001561 3300005356 Bacteria 12276
11 Ga0070674_100008449 3300005356 Bacteria 6130
12 Ga0070659_100023909 3300005366 Bacteria 4681
13 Ga0070678_100114345 3300005456 Bacteria 2117
14 Ga0070707_100037776 3300005468 Bacteria 4611
15 Ga0070699_100002519 3300005518 Bacteria 16450
16 Ga0070699_100155490 3300005518 Bacteria 2024
17 Ga0070679_100039620 3300005530 Bacteria 4683
18 Ga0070697_100113702 3300005536 Bacteria 2258
19 Ga0070665_100050273 3300005548 Bacteria 4183
20 Ga0068855_100012845 3300005563 Bacteria 10105
21 Ga0070664_100005631 3300005564 Bacteria 10084
22 Ga0070664_100028454 3300005564 Bacteria 4649
23 Ga0068864_100094930 3300005618 Bacteria 2637
24 Ga0068858_100091383 3300005842 Bacteria 2833
25 Ga0081538_10000626 3300005981 Bacteria 39230
26 Ga0081538_10003674 3300005981 Bacteria 14409
27 Ga0081538_10037171 3300005981 Bacteria 3165
28 Ga0081539_10022864 3300005985 Bacteria 4118
29 Ga0075366_10025402 3300006195 Bacteria 3460
30 Ga0075428_100096320 3300006844 Bacteria 3225
31 Ga0075430_100039894 3300006846 Bacteria 3974
32 Ga0075430_100306336 3300006846 Bacteria 1314
33 Ga0075431_100000173 3300006847 Bacteria 45790
34 Ga0075431_100056555 3300006847 Bacteria 4046
35 Ga0075433_10001998 3300006852 Bacteria 15355
36 Ga0075429_100082064 3300006880 Bacteria 2810
37 Ga0105240_10107635 3300009093 Bacteria 3380
38 Ga0111539_10005181 3300009094 Bacteria 16890
39 Ga0111539_10006769 3300009094 Bacteria 14750
40 Ga0114129_10018868 3300009147 Bacteria 9824
41 Ga0114129_10027988 3300009147 Bacteria 7982
42 Ga0114129_10029519 3300009147 Bacteria 7767
43 Ga0114129_10035476 3300009147 Bacteria 7045
44 Ga0114129_10258420 3300009147 Bacteria 2336
45 Ga0105248_10014798 3300009177 Bacteria 8592
46 Ga0105248_10043373 3300009177 Bacteria 5043
47 Ga0105248_10371210 3300009177 Bacteria 1611
48 Ga0105248_10438395 3300009177 Bacteria 1472
49 Ga0105249_10317762 3300009553 Bacteria 1568
50 Ga0105249_10320070 3300009553 Bacteria 1562
51 Ga0157380_10273903 3300014326 Bacteria 1540
52 Ga0157379_10000101 3300014968 Bacteria 58702
53 Ga0157379_10240332 3300014968 Bacteria 1643
54 Ga0157376_10195037 3300014969 Bacteria 1860
55 Ga0207645_10097961 3300025907 Bacteria 1890
56 Ga0207705_10139678 3300025909 Bacteria 1808
57 Ga0207657_10040187 3300025919 Bacteria 4147
58 Ga0207652_10062449 3300025921 Bacteria 3219
59 Ga0207650_10030549 3300025925 Bacteria 3882
60 Ga0207687_10061628 3300025927 Bacteria 2650
61 Ga0207690_10056102 3300025932 Bacteria 2656
62 Ga0207686_10077437 3300025934 Bacteria 2159
63 Ga0207670_10065142 3300025936 Bacteria 2500
64 Ga0207669_10002644 3300025937 Bacteria 7676
65 Ga0207704_10233225 3300025938 Bacteria 1370
66 Ga0207711_10030614 3300025941 Bacteria 4540
67 Ga0207711_10040845 3300025941 Bacteria 3948
68 Ga0207711_10195876 3300025941 Bacteria 1843
69 Ga0207679_10010479 3300025945 Bacteria 5969
70 Ga0207679_10012542 3300025945 Bacteria 5528
71 Ga0207679_10199667 3300025945 Bacteria 1670
72 Ga0207667_10086372 3300025949 Bacteria 3246
73 Ga0207668_10109731 3300025972 Bacteria 2068
74 Ga0207640_10290328 3300025981 Bacteria 1289
75 Ga0207675_100019314 3300026118 Bacteria 6358
76 Ga0207675_100080123 3300026118 Bacteria 3061
77 Ga0207428_10000505 3300027907 Bacteria 46673
78 Ga0207428_10295035 3300027907 Bacteria 1200
79 Ga0268265_10105630 3300028380 Bacteria 2285
80 Ga0268265_10304111 3300028380 Bacteria 1437
81 Ga0307412_10135436 3300031911 Bacteria 1796
82 Ga0307412_10367006 3300031911 Bacteria 1161
83 Ga0307409_100054976 3300031995 Bacteria 3070
84 Ga0307416_100059731 3300032002 Bacteria 3100
85 Ga0307416_100119920 3300032002 Bacteria 2341
86 Ga0307411_10183155 3300032005 Bacteria 1592
87 Ga0373923_0074735 3300035111 Bacteria 1461
88 Ga0373956_0086769 3300035119 Bacteria 1440
89 Ga0373924_0083520 3300035410 Bacteria 1361
90 Ga0373927_0089784 3300035695 Bacteria 1995
91 Ga0373933_0014349 3300035724 Bacteria 4405
92 Ga0373937_0005130 3300036401 Bacteria 11163
93 Ga0395901_0186623 3300038443 Bacteria 2175
94 Ga0395901_0275487 3300038443 Bacteria 1749
95 Ga0436363_1236966 3300039450 Bacteria 4218
96 Ga0466972_0000561 3300044658 Bacteria 18133
97 Ga0466965_0121670 3300044683 Bacteria 1348
98 Ga0466961_0007568 3300044693 Bacteria 6915
99 Ga0466963_0003363 3300044694 Bacteria 9134
100 Ga0466963_0003409 3300044694 Bacteria 9096
101 Ga0466957_0003223 3300044842 Bacteria 8929
102 Ga0466959_0018081 3300045049 Bacteria 5173
103 Ga0451576_0318757 3300045051 Bacteria 1627
104 Ga0466958_0001833 3300045836 Bacteria 10338
105 Ga0466958_0011690 3300045836 Bacteria 4952
106 Ga0466967_0005091 3300045976 Bacteria 9024
107 Ga0495639_0102513 3300046475 Bacteria 1352
108 Ga0495618_0236169 3300046514 Bacteria 1150
109 Ga0495658_0059938 3300046683 Bacteria 2181
110 Ga0495624_0117132 3300046690 Bacteria 1637
111 Ga0495675_0012447 3300047444 Bacteria 5355
112 Ga0495677_0046439 3300047445 Bacteria 1594
113 Ga0496104_0006425 3300048907 Bacteria 10336
114 Ga0496124_0157167 3300048927 Bacteria 1777
115 Ga0501034_0001926 3300049571 Bacteria 26283
116 Ga0501040_0026622 3300049576 Bacteria 3890
117 Ga0501040_0091690 3300049576 Bacteria 2112
118 Ga0501042_0100018 3300049578 Bacteria 2085
119 Ga0501046_0239625 3300049580 Bacteria 1338
120 Ga0501048_0288130 3300049582 Bacteria 1168
121 Ga0501072_0071365 3300049588 Bacteria 2744
122 Ga0501075_0060286 3300049591 Bacteria 2859
123 Ga0501076_0243554 3300049592 Bacteria 1471
124 Ga0501079_0206514 3300049741 Bacteria 1534
125 Ga0501080_0321751 3300049742 Bacteria 1400
126 Ga0501081_0078737 3300049743 Bacteria 2304
127 Ga0501283_002225 3300049779 Bacteria 2517
128 nmdc:mga0k408_6546_c2 3300050493 Bacteria 4618
129 nmdc:mga06z11_4006_c1 3300050494 Bacteria 5751
130 nmdc:mga05p37_363156_c1 3300050507 Bacteria 1702
131 nmdc:mga05p37_4392_c1 3300050507 Bacteria 16472
132 nmdc:mga05p37_444002_c1 3300050507 Bacteria 1504
133 nmdc:mga09592_106943_c1 3300050508 Bacteria 2399
134 nmdc:mga09592_12296_c1 3300050508 Bacteria 6969
135 nmdc:mga09592_219439_c1 3300050508 Bacteria 1648
136 nmdc:mga0qj67_72905_c1 3300050509 Bacteria 2742
137 nmdc:mga06r32_224_c1 3300050510 Bacteria 45758
138 nmdc:mga06r32_381499_c1 3300050510 Bacteria 1392
139 nmdc:mga08y16_29325_c1 3300050511 Bacteria 5798
140 nmdc:mga08y16_4860_c1 3300050511 Bacteria 14029
141 nmdc:mga0n895_29826_c1 3300050512 Bacteria 5205
142 nmdc:mga0n895_8106_c1 3300050512 Bacteria 9074
143 nmdc:mga0a205_12380_c1 3300050515 Bacteria 7890
144 nmdc:mga0a205_151706_c1 3300050515 Bacteria 2216
145 nmdc:mga0a205_643_c1 3300050515 Bacteria 27690
146 Ga0501084_0048015 3300054114 Bacteria 3575
147 Ga0590071_000175 3300059421 Bacteria 18493
148 Ga0590074_001502 3300059423 Bacteria 3769
149 Ga0590075_000082 3300059424 Bacteria 24320
150 Ga0590077_000047 3300059426 Bacteria 28149
151 Ga0501082_0289596 3300060353 Bacteria 1426
152 Ga0501082_0453717 3300060353 Bacteria 1120
153 Ga0466962_0016505 3300061719 Bacteria 3561
154 Ga0530510_0003934 3300061734 Bacteria 10244
155 Ga0070668_100070048
156 Ga0065712_10192220
157 Ga0065715_10158702
158 Ga0070658_10297489
159 Ga0070690_100048619
160 Ga0070670_100010776
161 Ga0070660_100029200
162 Ga0070689_100147808
163 Ga0070669_100096153
164 Ga0070674_100001561
165 Ga0070674_100008449
166 Ga0070659_100023909
167 Ga0070678_100114345
168 Ga0070707_100037776
169 Ga0070699_100002519
170 Ga0070699_100155490
171 Ga0070679_100039620
172 Ga0070697_100113702
173 Ga0070665_100050273
174 Ga0068855_100012845
175 Ga0070664_100005631
176 Ga0070664_100028454
177 Ga0068864_100094930
178 Ga0068858_100091383
179 Ga0081538_10000626
180 Ga0081538_10003674
181 Ga0081538_10037171
182 Ga0081539_10022864
183 Ga0075366_10025402
184 Ga0075428_100096320
185 Ga0075430_100039894
186 Ga0075430_100306336
187 Ga0075431_100000173
188 Ga0075431_100056555
189 Ga0075433_10001998
190 Ga0075429_100082064
191 Ga0105240_10107635
192 Ga0111539_10005181
193 Ga0111539_10006769
194 Ga0114129_10018868
195 Ga0114129_10027988
196 Ga0114129_10029519
197 Ga0114129_10035476
198 Ga0114129_10258420
199 Ga0105248_10014798
200 Ga0105248_10043373
201 Ga0105248_10371210
202 Ga0105248_10438395
203 Ga0105249_10317762
204 Ga0105249_10320070
205 Ga0157380_10273903
206 Ga0157379_10000101
207 Ga0157379_10240332
208 Ga0157376_10195037
209 Ga0207645_10097961
210 Ga0207705_10139678
211 Ga0207657_10040187
212 Ga0207652_10062449
213 Ga0207650_10030549
214 Ga0207687_10061628
215 Ga0207690_10056102
216 Ga0207686_10077437
217 Ga0207670_10065142
218 Ga0207669_10002644
219 Ga0207704_10233225
220 Ga0207711_10030614
221 Ga0207711_10040845
222 Ga0207711_10195876
223 Ga0207679_10010479
224 Ga0207679_10012542
225 Ga0207679_10199667
226 Ga0207667_10086372
227 Ga0207668_10109731
228 Ga0207640_10290328
229 Ga0207675_100019314
230 Ga0207675_100080123
231 Ga0207428_10000505
232 Ga0207428_10295035
233 Ga0268265_10105630
234 Ga0268265_10304111
235 Ga0307412_10135436
236 Ga0307412_10367006
237 Ga0307409_100054976
238 Ga0307416_100059731
239 Ga0307416_100119920
240 Ga0307411_10183155
241 Ga0373923_0074735
242 Ga0373956_0086769
243 Ga0373924_0083520
244 Ga0373927_0089784
245 Ga0373933_0014349
246 Ga0373937_0005130
247 Ga0395901_0186623
248 Ga0395901_0275487
249 Ga0436363_1236966
250 Ga0466972_0000561
251 Ga0466965_0121670
252 Ga0466961_0007568
253 Ga0466963_0003363
254 Ga0466963_0003409
255 Ga0466957_0003223
256 Ga0466959_0018081
257 Ga0451576_0318757
258 Ga0466958_0001833
259 Ga0466958_0011690
260 Ga0466967_0005091
261 Ga0495639_0102513
262 Ga0495618_0236169
263 Ga0495658_0059938
264 Ga0495624_0117132
265 Ga0495675_0012447
266 Ga0495677_0046439
267 Ga0496104_0006425
268 Ga0496124_0157167
269 Ga0501034_0001926
270 Ga0501040_0026622
271 Ga0501040_0091690
272 Ga0501042_0100018
273 Ga0501046_0239625
274 Ga0501048_0288130
275 Ga0501072_0071365
276 Ga0501075_0060286
277 Ga0501076_0243554
278 Ga0501079_0206514
279 Ga0501080_0321751
280 Ga0501081_0078737
281 Ga0501283_002225
282 nmdc:mga0k408_6546_c2
283 nmdc:mga06z11_4006_c1
284 nmdc:mga05p37_363156_c1
285 nmdc:mga05p37_4392_c1
286 nmdc:mga05p37_444002_c1
287 nmdc:mga09592_106943_c1
288 nmdc:mga09592_12296_c1
289 nmdc:mga09592_219439_c1
290 nmdc:mga0qj67_72905_c1
291 nmdc:mga06r32_224_c1
292 nmdc:mga06r32_381499_c1
293 nmdc:mga08y16_29325_c1
294 nmdc:mga08y16_4860_c1
295 nmdc:mga0n895_29826_c1
296 nmdc:mga0n895_8106_c1
297 nmdc:mga0a205_12380_c1
298 nmdc:mga0a205_151706_c1
299 nmdc:mga0a205_643_c1
300 Ga0501084_0048015
301 Ga0590071_000175
302 Ga0590074_001502
303 Ga0590075_000082
304 Ga0590077_000047
305 Ga0501082_0289596
306 Ga0501082_0453717
307 Ga0466962_0016505
308 Ga0530510_0003934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

35

273

0.98

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

36

340

0.98

PF04321

RmlD_sub_bind

RmlD substrate binding domain

33

225

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rpn-assembly3.cif.gz_C crystal structure of gdp-d-mannose 4,6-dehydratase in complexes with gdp and nadph 0.9768 2 320
1n7h-assembly1.cif.gz_A-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.9712 3 322
1n7g-assembly1.cif.gz_B crystal structure of the gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp-rhamnose. 0.9708 3 322
1n7g-assembly1.cif.gz_A crystal structure of the gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp-rhamnose. 0.9692 3 322
1n7h-assembly1.cif.gz_B-2 crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp 0.969 3 322
ID Description Score Start End Superfamily
1n7gB01 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9741 184 322 3.90.25.10
af_P0AC88_3_270_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9731 3 259 3.40.50.720
af_F1QPT3_45_368_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9599 26 314 3.40.50.720
af_Q4D941_50_182_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9578 184 297 3.90.25.10
1rpnA02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9563 184 320 3.90.25.10
ID Description Score Start End GO Terms
AF-A0A287VKI9-F1-model_v4 deleted 0.9986 150 259
AF-R7WDJ2-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) 0.995 155 321 GO:0008446
GO:0042351
AF-A0A146LA67-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.99 117 263 GO:0008446
GO:0042351
AF-K9ZLN4-F1-model_v4 GDP-mannose 4,6-dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) 0.9862 1 322 GO:0008446
GO:0042351
GO:0070401
AF-W9CZ40-F1-model_v4 deleted 0.9842 56 321

Map