F218129

General Info

Members Datasets Scaffolds Average Seq Length
153 120 123 342

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0045029|Ga0501067_0045029_1189_2415
Length 408
Sequence MARAIRNRCEVRSFPNGVFRDTVLHVTVIAVLCSRGFVGALRALSNYHEYGNHAGVGAHRVWWVSGTGMMTRALRIEKENVTRFHDVPLGAPGEGEVRVSVRHVGLCGSDLNTFRGLNPLVQLPRIPGHEIGGEIVAAGPGVSADYAVGKRVIVMPYTSCGKCASCRKGRVNACRYNRTLGVQQDGGLAEEINVPAEKLILNETLAPRHLALVEPLSVGFHAVGRGRVTADDTVAVIGCGMIGMGVLIGAVARGARVIAIDPSEEKRSLAMRFGAAHVLPAGGEEVVAEINRLTGDDGVDVAFEAVGLPATFTQAVDLAGFSGRVVYVGYSKTPVTYQTQFFNLKELDIMGSRNATLDDFHAVIEHLETIGAAADALISRVFPFDEAEAALPYWDGDRDVLKIIVERA

Samples

Sample ID Description Type Environment
1 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
2 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
3 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
4 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
5 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
6 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
7 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
8 2751185800 Brucella pituitosa AA2 Isolate Unclassified
9 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
10 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
11 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
12 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
13 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
14 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
15 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
16 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
17 2844163670 Ensifer sp. 1H6 Isolate Unclassified
18 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
19 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
20 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
21 2854911287 Brucella lupini LUP21 Isolate Unclassified
22 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
23 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
24 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
25 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
26 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
29 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
30 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
31 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
32 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
33 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
47 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
54 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
81 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
82 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
83 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
84 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
87 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
88 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
89 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
90 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
111 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
112 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
113 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
114 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
118 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
119 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
120 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.74
Metatranscriptomes 0.65
Isolates 19.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 7.19
Rhizoplane 0.65
Rhizosphere 60.13
Stem 0
Stem Tuber 0
Unclassified 20.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000147 3300001979 Bacteria 27352
2 JGI25162J39368_1000288 3300002737 Bacteria 47072
3 JGI25159J45721_1000387 3300002987 Bacteria 20451
4 JGI25165J46597_1000068 3300003214 Bacteria 196201
5 JGI25160J50197_1000022 3300003354 Bacteria 201071
6 JGI25161J50226_1000139 3300003374 Bacteria 50307
7 Ga0058692_1008176 3300003856 Bacteria 2709
8 Ga0055543_1000125 3300004625 Bacteria 63343
9 Ga0065165_1001084 3300005262 Bacteria 32438
10 Ga0070658_10000048 3300005327 Bacteria 122132
11 Ga0070670_100000186 3300005331 Bacteria 56675
12 Ga0070659_100001953 3300005366 Bacteria 14730
13 Ga0068856_100050526 3300005614 Bacteria 4099
14 Ga0105240_10000002 3300009093 Bacteria 1924170
15 Ga0157380_10103110 3300014326 Bacteria 2380
16 Ga0213875_10000005 3300021388 Bacteria 595146
17 Ga0209563_102444 3300025230 Bacteria 4204
18 Ga0209437_100067 3300025233 Bacteria 317685
19 Ga0209233_1000088 3300025261 Bacteria 317980
20 Ga0209130_1000108 3300025284 Bacteria 133733
21 Ga0209130_1018572 3300025284 Bacteria 1628
22 Ga0207426_1000082 3300025302 Bacteria 298939
23 Ga0207695_10000002 3300025913 Bacteria 2188391
24 Ga0207650_10000437 3300025925 Bacteria 36104
25 Ga0207702_10038134 3300026078 Bacteria 4025
26 Ga0209371_1004703 3300027312 Bacteria 5792
27 Ga0265319_1002344 3300028563 Bacteria 10425
28 Ga0265319_1002439 3300028563 Bacteria 10159
29 Ga0265319_1007048 3300028563 Bacteria 5109
30 Ga0265319_1019179 3300028563 Bacteria 2561
31 Ga0265318_10048182 3300028577 Bacteria 1606
32 Ga0265323_10001547 3300028653 Bacteria 11138
33 Ga0265338_10086991 3300028800 Bacteria 2598
34 Ga0268256_1006087 3300030500 Bacteria 4562
35 Ga0265320_10000108 3300031240 Bacteria 71696
36 Ga0265320_10001821 3300031240 Bacteria 15120
37 Ga0265320_10003018 3300031240 Bacteria 11465
38 Ga0265320_10007509 3300031240 Bacteria 6762
39 Ga0265331_10010251 3300031250 Bacteria 5195
40 Ga0265316_10003843 3300031344 Bacteria 15064
41 Ga0265316_10006524 3300031344 Bacteria 11127
42 Ga0265313_10000469 3300031595 Bacteria 42166
43 Ga0265314_10028945 3300031711 Bacteria 4123
44 Ga0307516_10127591 3300031730 Bacteria 2327
45 Ga0307414_10000458 3300032004 Bacteria 21425
46 Ga0307414_10000515 3300032004 Bacteria 20106
47 Ga0307510_10013498 3300033180 Bacteria 9688
48 Ga0436364_0157811 3300037853 Bacteria 430293
49 Ga0436364_1322554 3300037853 Bacteria 2881
50 Ga0451577_0001750 3300042876 Bacteria 27986
51 Ga0451577_0003054 3300042876 Bacteria 19022
52 Ga0453683_0127475 3300044673 Bacteria 1603
53 Ga0466963_0149494 3300044694 Bacteria 1621
54 Ga0453684_0000549 3300044712 Bacteria 141927
55 Ga0453684_0004119 3300044712 Bacteria 31519
56 Ga0453684_0023314 3300044712 Bacteria 9126
57 Ga0453684_0045130 3300044712 Bacteria 5884
58 Ga0453684_0068019 3300044712 Bacteria 4525
59 Ga0453684_0086008 3300044712 Bacteria 3904
60 Ga0453684_0111101 3300044712 Bacteria 3330
61 Ga0466970_0000752 3300044765 Bacteria 15717
62 Ga0466957_0170721 3300044842 Bacteria 1416
63 Ga0466959_0091737 3300045049 Bacteria 2181
64 Ga0451576_0097982 3300045051 Bacteria 3049
65 Ga0451576_0394261 3300045051 Bacteria 1451
66 Ga0466958_0005001 3300045836 Bacteria 7079
67 Ga0466967_0037012 3300045976 Bacteria 4172
68 Ga0495592_0016383 3300046454 Bacteria 5624
69 Ga0495629_0015851 3300046459 Bacteria 5414
70 Ga0495662_0012469 3300046476 Bacteria 4148
71 Ga0495606_0016048 3300046507 Bacteria 5735
72 Ga0495587_0030715 3300046536 Bacteria 3258
73 Ga0495622_0043453 3300046557 Bacteria 2089
74 Ga0495657_0080039 3300046675 Bacteria 2115
75 Ga0495624_0050299 3300046690 Bacteria 2641
76 Ga0495604_0026151 3300047317 Bacteria 4646
77 Ga0495686_0000090 3300047472 Bacteria 193179
78 Ga0495686_0023212 3300047472 Bacteria 4094
79 Ga0496119_0004333 3300048922 Bacteria 14169
80 Ga0496119_0109442 3300048922 Bacteria 1536
81 Ga0496120_0079109 3300048923 Bacteria 1785
82 Ga0496120_0134484 3300048923 Bacteria 1262
83 Ga0496121_0111442 3300048924 Bacteria 2086
84 Ga0496122_0006900 3300048925 Bacteria 12837
85 Ga0496122_0009075 3300048925 Bacteria 10550
86 Ga0496122_0012762 3300048925 Bacteria 8315
87 Ga0496123_0008551 3300048926 Bacteria 9385
88 Ga0496123_0022938 3300048926 Bacteria 4794
89 Ga0496125_0008542 3300048928 Bacteria 10704
90 Ga0496125_0033583 3300048928 Bacteria 4537
91 Ga0496125_0084285 3300048928 Unclassified 2414
92 Ga0496125_0110863 3300048928 Bacteria 1987
93 Ga0501033_0000026 3300049570 Bacteria 169104
94 Ga0501033_0005840 3300049570 Bacteria 9679
95 Ga0501034_0003055 3300049571 Bacteria 19328
96 Ga0501036_0001315 3300049572 Bacteria 19056
97 Ga0501037_0004241 3300049573 Bacteria 10400
98 Ga0501038_0002280 3300049574 Bacteria 17849
99 Ga0501039_0002927 3300049575 Bacteria 12775
100 Ga0501039_0044987 3300049575 Bacteria 3410
101 Ga0501040_0007819 3300049576 Bacteria 6924
102 Ga0501042_0003824 3300049578 Bacteria 9518
103 Ga0501046_0002355 3300049580 Bacteria 17801
104 Ga0501046_0302424 3300049580 Bacteria 1168
105 Ga0501048_0001333 3300049582 Bacteria 18714
106 Ga0501048_0092584 3300049582 Bacteria 2132
107 Ga0501067_0045029 3300049583 Bacteria 2451
108 Ga0501070_0001529 3300049586 Bacteria 20585
109 Ga0501071_0002932 3300049587 Bacteria 10537
110 Ga0501073_0007507 3300049589 Bacteria 8099
111 Ga0501080_0002779 3300049742 Bacteria 15373
112 Ga0501083_0014028 3300049744 Bacteria 5601
113 Ga0501035_0000382 3300049822 Bacteria 50839
114 Ga0501035_0229170 3300049822 Bacteria 1583
115 Ga0501044_0002860 3300049823 Bacteria 19649
116 Ga0501044_0217860 3300049823 Bacteria 1860
117 Ga0500595_000005 3300053119 Bacteria 340896
118 Ga0500608_114615 3300053122 Bacteria 1231
119 Ga0500573_0051942 3300053140 Bacteria 2357
120 Ga0500590_043004 3300053148 Bacteria 2318
121 Ga0500636_0055666 3300053177 Bacteria 2318
122 Ga0501084_0216671 3300054114 Bacteria 1615
123 Ga0587072_009753 3300059643 Bacteria 1540

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044673 Ga0453683_0127475 Ga0453683_0127475_42_920 289
2 3300049580 Ga0501046_0302424 Ga0501046_0302424_256_1158 297
3 3300028577 Ga0265318_10048182 Ga0265318_100481822 324
4 3300028563 Ga0265319_1007048 Ga0265319_10070482 327
5 3300028800 Ga0265338_10086991 Ga0265338_100869913 327
6 3300031240 Ga0265320_10001821 Ga0265320_100018214 327
7 3300031250 Ga0265331_10010251 Ga0265331_100102512 327
8 3300031595 Ga0265313_10000469 Ga0265313_100004695 327
9 3300042876 Ga0451577_0001750 Ga0451577_0001750_26833_27849 327
10 3300037853 Ga0436364_1322554 Ga0436364_1322554_330_1352 330
11 3300005327 Ga0070658_10000048 Ga0070658_1000004872 332
12 3300005366 Ga0070659_100001953 Ga0070659_1000019538 332
13 3300033180 Ga0307510_10013498 Ga0307510_100134988 332
14 3300053119 Ga0500595_000005 Ga0500595_000005_319626_320627 332
15 iso_pu_bacteria 2523231067 2523466253 332
16 iso_pu_bacteria 2738543031 2739347024 332
17 iso_pu_bacteria 2910245624 2910250339 332
18 iso_pu_bacteria 2919692658 2919693177 332
19 3300046454 Ga0495592_0016383 Ga0495592_0016383_3912_4919 333
20 3300046459 Ga0495629_0015851 Ga0495629_0015851_1587_2594 333
21 3300046476 Ga0495662_0012469 Ga0495662_0012469_189_1196 333
22 3300046536 Ga0495587_0030715 Ga0495587_0030715_669_1676 333
23 3300046557 Ga0495622_0043453 Ga0495622_0043453_99_1106 333
24 3300046675 Ga0495657_0080039 Ga0495657_0080039_358_1365 333
25 3300046690 Ga0495624_0050299 Ga0495624_0050299_708_1715 333
26 3300047317 Ga0495604_0026151 Ga0495604_0026151_216_1223 333
27 3300048922 Ga0496119_0109442 Ga0496119_0109442_199_1206 333
28 3300048923 Ga0496120_0134484 Ga0496120_0134484_76_1083 333
29 3300048924 Ga0496121_0111442 Ga0496121_0111442_390_1397 333
30 3300048925 Ga0496122_0006900 Ga0496122_0006900_1684_2685 333
31 3300048926 Ga0496123_0022938 Ga0496123_0022938_800_1801 333
32 3300048928 Ga0496125_0084285 Ga0496125_0084285_887_1888 333
33 3300053148 Ga0500590_043004 Ga0500590_043004_308_1315 333
34 3300053177 Ga0500636_0055666 Ga0500636_0055666_290_1297 333
35 iso_pu_bacteria 2582581316 2585335830 333
36 iso_pu_bacteria 2597490356 2599105929 333
37 iso_pu_bacteria 2615840698 2616552167 333
38 iso_pu_bacteria 2667528174 2671114166 333
39 iso_pu_bacteria 2751185800 2753358048 333
40 iso_pu_bacteria 2757320392 2757571195 333
41 iso_pu_bacteria 2758568016 2758639176 333
42 iso_pu_bacteria 2838029111 2838032699 333
43 iso_pu_bacteria 2842475841 2842479431 333
44 iso_pu_bacteria 2842502639 2842506410 333
45 iso_pu_bacteria 2844163670 2844165939 333
46 iso_pu_bacteria 2846952575 2846955716 333
47 iso_pu_bacteria 2848858292 2848862838 333
48 iso_pu_bacteria 2854911287 2854916276 333
49 iso_pu_bacteria 2915650412 2915652823 333
50 iso_pu_bacteria 2917554339 2917556452 333
51 iso_pu_bacteria 2919408235 2919412510 333
52 iso_pu_bacteria 8005682033 8005684284 333
53 iso_pu_bacteria 2524023209 2524458556 334
54 iso_pu_bacteria 2842298080 2842300184 334
55 iso_pu_bacteria 2842357229 2842359095 334
56 iso_pu_bacteria 2842509118 2842511620 334
57 iso_pu_bacteria 2852387548 2852391793 334
58 iso_pu_bacteria 8046767195 8046767313 334
59 iso_pu_bacteria 8057575449 8057580077 334
60 3300009093 Ga0105240_10000002 Ga0105240_100000021370 335
61 3300025913 Ga0207695_10000002 Ga0207695_100000021373 335
62 3300014326 Ga0157380_10103110 Ga0157380_101031102 336
63 3300021388 Ga0213875_10000005 Ga0213875_10000005185 336
64 3300028563 Ga0265319_1002344 Ga0265319_10023445 336
65 3300028563 Ga0265319_1002439 Ga0265319_10024399 336
66 3300028563 Ga0265319_1019179 Ga0265319_10191792 336
67 3300028653 Ga0265323_10001547 Ga0265323_100015477 336
68 3300031240 Ga0265320_10000108 Ga0265320_1000010815 336
69 3300031240 Ga0265320_10003018 Ga0265320_100030184 336
70 3300031240 Ga0265320_10007509 Ga0265320_100075096 336
71 3300031344 Ga0265316_10003843 Ga0265316_1000384310 336
72 3300031344 Ga0265316_10006524 Ga0265316_100065243 336
73 3300031711 Ga0265314_10028945 Ga0265314_100289453 336
74 3300032004 Ga0307414_10000515 Ga0307414_100005154 336
75 3300037853 Ga0436364_0157811 Ga0436364_0157811_374945_375973 336
76 3300044712 Ga0453684_0004119 Ga0453684_0004119_8435_9454 336
77 3300044712 Ga0453684_0023314 Ga0453684_0023314_3154_4173 336
78 3300044712 Ga0453684_0045130 Ga0453684_0045130_4352_5368 336
79 3300044712 Ga0453684_0068019 Ga0453684_0068019_2469_3488 336
80 3300044712 Ga0453684_0086008 Ga0453684_0086008_1466_2485 336
81 3300048925 Ga0496122_0009075 Ga0496122_0009075_4434_5450 336
82 3300048926 Ga0496123_0008551 Ga0496123_0008551_215_1231 336
83 3300048928 Ga0496125_0008542 Ga0496125_0008542_7940_8956 336
84 3300048928 Ga0496125_0033583 Ga0496125_0033583_962_1978 336
85 3300048928 Ga0496125_0110863 Ga0496125_0110863_49_1065 336
86 iso_pu_bacteria 8024486573 8024490278 336
87 3300001979 JGI24740J21852_10000147 JGI24740J21852_100001476 337
88 3300002737 JGI25162J39368_1000288 JGI25162J39368_100028824 337
89 3300002987 JGI25159J45721_1000387 JGI25159J45721_100038718 337
90 3300003214 JGI25165J46597_1000068 JGI25165J46597_1000068176 337
91 3300003354 JGI25160J50197_1000022 JGI25160J50197_1000022157 337
92 3300003374 JGI25161J50226_1000139 JGI25161J50226_100013918 337
93 3300003856 Ga0058692_1008176 Ga0058692_10081762 337
94 3300004625 Ga0055543_1000125 Ga0055543_100012519 337
95 3300005262 Ga0065165_1001084 Ga0065165_100108411 337
96 3300005331 Ga0070670_100000186 Ga0070670_10000018641 337
97 3300005614 Ga0068856_100050526 Ga0068856_1000505261 337
98 3300025230 Ga0209563_102444 Ga0209563_1024443 337
99 3300025233 Ga0209437_100067 Ga0209437_100067248 337
100 3300025261 Ga0209233_1000088 Ga0209233_1000088248 337
101 3300025284 Ga0209130_1000108 Ga0209130_100010825 337
102 3300025284 Ga0209130_1018572 Ga0209130_10185722 337
103 3300025302 Ga0207426_1000082 Ga0207426_1000082170 337
104 3300025925 Ga0207650_10000437 Ga0207650_1000043720 337
105 3300026078 Ga0207702_10038134 Ga0207702_100381341 337
106 3300027312 Ga0209371_1004703 Ga0209371_10047032 337
107 3300030500 Ga0268256_1006087 Ga0268256_10060872 337
108 3300031730 Ga0307516_10127591 Ga0307516_101275911 337
109 3300032004 Ga0307414_10000458 Ga0307414_100004589 337
110 3300042876 Ga0451577_0003054 Ga0451577_0003054_7207_8235 337
111 3300044694 Ga0466963_0149494 Ga0466963_0149494_179_1192 337
112 3300044712 Ga0453684_0000549 Ga0453684_0000549_120691_121719 337
113 3300044712 Ga0453684_0111101 Ga0453684_0111101_379_1404 337
114 3300044765 Ga0466970_0000752 Ga0466970_0000752_9275_10288 337
115 3300044842 Ga0466957_0170721 Ga0466957_0170721_253_1266 337
116 3300045049 Ga0466959_0091737 Ga0466959_0091737_587_1600 337
117 3300045051 Ga0451576_0097982 Ga0451576_0097982_1477_2505 337
118 3300045051 Ga0451576_0394261 Ga0451576_0394261_207_1298 337
119 3300045836 Ga0466958_0005001 Ga0466958_0005001_2323_3336 337
120 3300045976 Ga0466967_0037012 Ga0466967_0037012_940_1953 337
121 3300046507 Ga0495606_0016048 Ga0495606_0016048_3724_4746 337
122 3300047472 Ga0495686_0000090 Ga0495686_0000090_21617_22639 337
123 3300047472 Ga0495686_0023212 Ga0495686_0023212_881_1903 337
124 3300048922 Ga0496119_0004333 Ga0496119_0004333_5700_6713 337
125 3300048923 Ga0496120_0079109 Ga0496120_0079109_365_1378 337
126 3300048925 Ga0496122_0012762 Ga0496122_0012762_6784_7797 337
127 3300049570 Ga0501033_0000026 Ga0501033_0000026_80061_81080 337
128 3300049570 Ga0501033_0005840 Ga0501033_0005840_516_1538 337
129 3300049571 Ga0501034_0003055 Ga0501034_0003055_7991_9166 337
130 3300049572 Ga0501036_0001315 Ga0501036_0001315_10163_11338 337
131 3300049573 Ga0501037_0004241 Ga0501037_0004241_5647_6822 337
132 3300049574 Ga0501038_0002280 Ga0501038_0002280_7991_9166 337
133 3300049575 Ga0501039_0002927 Ga0501039_0002927_8402_9577 337
134 3300049575 Ga0501039_0044987 Ga0501039_0044987_1558_2670 337
135 3300049576 Ga0501040_0007819 Ga0501040_0007819_1506_2681 337
136 3300049578 Ga0501042_0003824 Ga0501042_0003824_2812_3987 337
137 3300049580 Ga0501046_0002355 Ga0501046_0002355_5571_6746 337
138 3300049582 Ga0501048_0001333 Ga0501048_0001333_10283_11458 337
139 3300049582 Ga0501048_0092584 Ga0501048_0092584_497_1519 337
140 3300049583 Ga0501067_0045029 Ga0501067_0045029_1189_2415 337
141 3300049586 Ga0501070_0001529 Ga0501070_0001529_10924_12099 337
142 3300049587 Ga0501071_0002932 Ga0501071_0002932_7326_8501 337
143 3300049589 Ga0501073_0007507 Ga0501073_0007507_96_1271 337
144 3300049742 Ga0501080_0002779 Ga0501080_0002779_10978_12153 337
145 3300049744 Ga0501083_0014028 Ga0501083_0014028_2140_3315 337
146 3300049822 Ga0501035_0000382 Ga0501035_0000382_13184_14203 337
147 3300049822 Ga0501035_0229170 Ga0501035_0229170_472_1548 337
148 3300049823 Ga0501044_0002860 Ga0501044_0002860_10479_11501 337
149 3300049823 Ga0501044_0217860 Ga0501044_0217860_23_1099 337
150 3300053122 Ga0500608_114615 Ga0500608_114615_70_1092 337
151 3300053140 Ga0500573_0051942 Ga0500573_0051942_463_1476 337
152 3300054114 Ga0501084_0216671 Ga0501084_0216671_175_1197 337
153 3300059643 Ga0587072_009753 Ga0587072_009753_234_1256 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

242

369

0.96

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

93

204

0.96

PF16912

Glu_dehyd_C

Glucose dehydrogenase C-terminus

208

406

0.76

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

273

405

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vm2-assembly1.cif.gz_A crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli 0.9347 2 336
4ilk-assembly1.cif.gz_A crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9321 2 337
5vm2-assembly1.cif.gz_A crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli 0.9266 2 336
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9264 1 336
4ilk-assembly1.cif.gz_B crystal structure of short chain alcohol dehydrogenase (rspb) from e. coli cft073 (efi target efi-506413) complexed with cofactor nadh 0.9263 2 337
ID Description Score Start End Superfamily
af_P39400_4_147_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9663 1 142 3.90.180.10
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9603 156 279 3.40.50.720
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9537 162 193 3.50.50.60
af_P77280_1_347_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.952 2 336 3.90.180.10
4cpdB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9508 150 281 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0F5L5P3-F1-model_v4 Sorbitol dehydrogenase 0.9831 1 337 GO:0008270
GO:0016491
AF-A0A6L3II11-F1-model_v4 Zinc-binding dehydrogenase 0.9818 67 263 GO:0016491
AF-A0A0F5L5P3-F1-model_v4 Sorbitol dehydrogenase 0.9802 1 337 GO:0008270
GO:0016491
AF-A0A6L3II11-F1-model_v4 Zinc-binding dehydrogenase 0.9769 67 263 GO:0016491
AF-A0A4R8MFD1-F1-model_v4 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase 0.9737 1 336 GO:0016491

Feature Viewer

pLDDT pTM Quality
96.34 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map